SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384582 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384582
Domain Number 1 Region: 1747-1881
Classification Level Classification E-value
Superfamily CalX-like 5.62e-31
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 2 Region: 300-453
Classification Level Classification E-value
Superfamily CalX-like 3.53e-29
Family CalX-beta domain 0.004
Further Details:      
 
Domain Number 3 Region: 665-786
Classification Level Classification E-value
Superfamily CalX-like 1.44e-27
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 4 Region: 185-316
Classification Level Classification E-value
Superfamily CalX-like 2.22e-27
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 5 Region: 2076-2220
Classification Level Classification E-value
Superfamily CalX-like 3.14e-26
Family CalX-beta domain 0.00072
Further Details:      
 
Domain Number 6 Region: 1393-1475
Classification Level Classification E-value
Superfamily CalX-like 4.45e-23
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 7 Region: 55-200
Classification Level Classification E-value
Superfamily CalX-like 2.88e-22
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 8 Region: 2472-2609
Classification Level Classification E-value
Superfamily CalX-like 6.54e-22
Family CalX-beta domain 0.0081
Further Details:      
 
Domain Number 9 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 1478-1623
Classification Level Classification E-value
Superfamily CalX-like 6.41e-21
Family CalX-beta domain 0.0072
Further Details:      
 
Domain Number 11 Region: 2964-3103
Classification Level Classification E-value
Superfamily CalX-like 6.41e-21
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 12 Region: 3175-3333
Classification Level Classification E-value
Superfamily CalX-like 6.41e-20
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 13 Region: 510-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 14 Region: 570-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 15 Region: 1860-1999
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000275
Family CalX-beta domain 0.0073
Further Details:      
 
Domain Number 16 Region: 1981-2086
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000641
Family CalX-beta domain 0.0087
Further Details:      
 
Domain Number 17 Region: 2212-2362
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000114
Family CalX-beta domain 0.0057
Further Details:      
 
Domain Number 18 Region: 3457-3603
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000144
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 19 Region: 905-1018
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000602
Family CalX-beta domain 0.0086
Further Details:      
 
Domain Number 20 Region: 1585-1720
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000837
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 21 Region: 2-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000131
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 22 Region: 2346-2461
Classification Level Classification E-value
Superfamily CalX-like 0.0000000051
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 23 Region: 2572-2676
Classification Level Classification E-value
Superfamily CalX-like 0.000000379
Family CalX-beta domain 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384582
Domain Number - Region: 3324-3442
Classification Level Classification E-value
Superfamily CalX-like 0.00759
Family CalX-beta domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384582
Sequence length 4166
Comment GPR98 (Homo_sapiens) G protein-coupled receptor 98
Sequence
MLEILPDENPELDKAFSVLILSVSSGSLGVHTNATLIVLASDDPYGVFIFSEESRPITVE
EATQNVTLSIVRLRGLLGKVRVSYATVDDTEKPPYFPPNLARATQGRDYVSASGFALFVA
NQSEATITISVLDDDEPERLESVFIELLSPVLVEKVQNCPIPNSPRLGVQVETVAHLTIL
ANDDPFGTLQLSTPVVRVAENHVGPIINVTRTGGAFADVSVKFKAVPITAIAGEDYSVAS
SDVVLLEGETSKAVPIYIINDIYPELEESFLIQLLNETTGGAAVGALTEAIIIIEASDDP
YGLFGFQINKLIVEEPEFNSVKVNLPIIQNSGTLGNVTVQWVATINGQLATGDLRVVSGN
VTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTVGLDRVASIIIPANDNPYGT
VAFVQSVYRVQEPLERSSCANITVRRSGGHFGQLLLLYSTSDIDAVSLTVEEGQDVLSYY
ELPVRGLPDPLWEDWVNVSAVGEPQYTCATLCLRQQACLAFSFLSTAEGPQCFWMTLWIS
PTVNSSDFRTYRKNMTRVVSLFSGQAVAGSDYEPVTRQWAMMLEGDEFANLTVSVLPDDF
PEMDESFLISLLEVHLMNITASFKNQPTIGQPNTSTVVIALNGDAFGVFVIYSIGRNTSE
DGSFVEVQEQPQTLVELMIHRTGGSLGQVTVEWRVAGGTATEGLHFIGAGDILTFAEGET
KKTAILTILDDAKPEGDESIIVSLVNTEGGSRILPSSDTVRVNILANDNVAGIVSFQMAS
RSVIGHEDAEGLAAQIIIDANDGAQGVIEWQCSSWTKLGHPLPEEEAAGSCPSESEGRSW
EFRAQHLQQCWPHSHRSALSSGAESEHWAALVTVLANDDGPGVLSFNNSERLFLREPAAA
SVSLSAQQSEAVLSVVREPAQGLFGTVTVQFPVTEANSSAESQDLTPSRGYIVLEEGVRF
KFCVCVCVCVCTEPEMAEHFVCTLFNPTGGARLGSRVETLITVLQNQAPLGLFSISAVDN
RATSINTEEANRTVYLNVSRTNGIELAVNVQWETVSETAFGMRGMDVVLSIIQSFLNESA
AGWCFFTLEDSLYGIMLRKSSFTLYRWQGIFIPLEDVNMENPKMCEAFHIGLSPYFVITH
KERNGENLSANSVYTLTSGFKLFLVQTIIISESSQVKYFTSDNQDYLIVASQRDDSELTQ
VFRWTGGIFVPHQKLPVRGVLATAMFLRGGSVFLTLSQADAALVLRWSSGVFATSQELPV
SGTTQLETLSLGNDVYLIFAKNISLGDQNSIEIFIWETGQPSFRYFQSVDFATVNRIHSF
TPASGIAHILLAGPEASALYGWDSGRSQFSLLLEAPSAHAAASVTVRSLNSSKSLVLVAG
VPHSHVLELASVSSQSDFVPGSGELIFEPGDREAIIAVTILDDAVPEEEESFRVQLKNPT
GGAEIGTHGSVKITILSNDDAHGVVAFAQNSLYKQVEEMEQDSLVTLNVERLKGTYGHVT
VVWEADGSVDDIFPTSGVISFAEGQTLSTITLTVLADDTPELSEVVTVTLAHITTEGVED
PSRGAAIHLQRNKSVITTLPSDSPHGLVGWHSGSLLSRVAEPAENITILQLQIVRDEGLF
GDVAIHLIAKPNLLLHINNQATENEDYVLQETIIMMKENIKETHAKIAILPDDAPELEEG
FVVAITEVNLVSSDFSAEPPRVRRPGLETAEVVIEENDDPRGVFKFHVTRDAGGTVAAHE
LPPPLNILLIPVARLAGSFGLVSVHWTATPGSAGSEDFLPSLGTLEFADGQVTAAIEVTI
IDDAEYELMEMFSISLTSVSGGGTLGDDVVLTVVIPQNDSPFGVFGFEEQTVMVDESLVS
DDPDSSVMLMVVRSPGGKGPVQLQWVVEDKAKDDLSPLKGILHFDETESQKSIILRALQG
TARDWDRCFTIQLTAADEVEIAPGKGRASIIIRGEKAATGNVGIAPSSRHVLIGEPSATY
NGTAVISLVRGPSISGEVTVWWRIFPPSLEKFAEASGKLTMQDGQSAAIVVIQALNDNIP
EEKRFYEFQLTDISEGAGLSPSSHTANITMVASDAPYGHFAFSQEQLQVSEEVQRVNVTV
VRAGGYFGLVRLWFETVGGTADAGVDFVPVAGQLLFQAGEMARGLQVEILDDDHPEGPED
FSLVIMKVELQGRGYDFAIQGNGLQIDQPPEIGNISTIQIIIMKNDNAEGIIEFDPKYTA
FQVEEDVGVVAIPVVRLRGTYGHVAADFVARSPSAVPGGVDHILHSASVAFQHGQNLSFI
LVSVAGGEGSGSQGPLEVLLTRAAGGALLGRHLVSRVTVAPGGAPFGVVRFLNQSSISLL
SPDSTTLLPLALERTGGLLGEVQVAWDIVGPNSEEALSPLNGRIADPVRGSFYFAEGEGG
VRTLLLTICPHGEPEVEETFTVNLKLVKGEAKLDSRAKAVTLIIRKRGGPSGVVSFASES
TSVKTYVEPLAAEGPLLITFFVKRVKGTFGEITVYWGLRSEFDITGDFLSTNGFFTIAEG
ESDASFDIHLLPDDTPEVEETYAVQLLSVEGGADLDLNSSIAWFSVLANDNPHGVFALYS
EHQSVLVGQNLIRSIQVNVTRLAGTFGDVAVKFQILSEQKAQPVVTENVERQLVVEDGVT
CKVAAVPMRSQVFLSLGSNFTVQLVTVMLVSGHSDSRPTILQEAKSAVFPVPENAANSQV
GFESTAARLLDVVSGWSQVTVCRRGTYGALAVAWTTGYAPAPGWETPKAVLTGNMTPALV
SLLGVSELQRAPGPPPVTCALCGSCVALLRTLGGSEPVPLAFLPRVLLVPRKTPSPAVRD
SVNPAGGQARLSMRTEGFNVPRSQRAKKLHKTRKSVRRCERAVRKAALTALSPTQQAYQK
SDESKRLVETHSHRNLDVMCSFLCMFAPGSLSFSHGEARKHVSLRTFPSPGQAEAFAIHL
SGVQSSAPGGARLRPGFTVAEIEPMGIFQFSPSSRNITVSEDARLVRLQLQRLYGFHGDL
VKVSYETVAGSAKPMEDFELIQSGEVFFHKFQTEVDFEIAIINDQIPEKEEIFYINLTSI
DTGGLEKLDVNWRPRLNLHLGVAVITVLDDDHPAGMEVSVPMTAVAVAVGTPLIPPDTDS
TTHPGTGRTTAIPQAAETLATVPEATGIPATPEKPVTHHRPSTMPEKPDEANVSDHGTFS
LGPAVIYVEEEMKNGTLSTAEILIRRTGGFAGNVSVTVRTFGERCAQKEPNALPFPDTYG
VTNLSWAAEGQDFEEQMLSLTFLHGEREHRVSVPIVDDEEPEGQKFFYVFLTDPQGGAQI
VKGEDDAGFTAFAVVIITGSDLHNGILGFSEDSQSGMELGAGAEERRLRLVVTRQPNRAF
EDVQIHWRVSLNKSAVILQKEGLDLRDELLSVSGTTTCMAGRVQCLISLELKPEETLLVE
MHYFFVELYEVTAGAAINNSARFARIGVSQRRDAQSLIYFSVGSRLAVAHRKATLISLQV
TRDSAVRPTVSVSFSTQELRSAETIGRTLVSPAVSGKDFERTEGTLLFEPGQRDTVLDVI
LMPETGSSRPFPKRFQVVLFDPKGGARIDGVYGTANVTLVSDAASQAIWGLADQLQQPLD
EDILRRVLHSISVKVTTESTEEQLSAAMHVMEKITVEGRNEAFSVESRALFYEILCALVN
PEREDTRGFSHLTDVTESFAFALLTDVPCGSAAEKSKTILDSCPYLSIMAFHWDLQQING
HKFVGKEGDYIQIPERLLDAPDAGTVPGESTCKLVQFTEYSSQQWFVTANNLPALKNKVL
SLSVKGQSSQVLANNNEVLYRIYAAEPRIVPQSSLCLLWNQATESWWPDSPLCRVVGVTT
GYVDCACSHMSVYAVYAQTHTLSAYNEAFFSSGFICISGLSLTVVSQVFCAGCSTCAAKL
LMHMMAAGLGTQIVFLVSAYASPQLSEEGCSAIAAVTHYLYLCQFSWMLVQSVNFWYVLV
MSDEHTERRCLLFLLLGWGLPALVVILLIVVLRGVHHQSMPQIYGLVHGDLCCIPNVYTA
LFVAGLAPLACLVVVLVVFVHAYQVKPQWKAYDDVFRGRTNGADHCGCLGTNSPGFLSVS
VPNCSTTLKHKTVPIPDSIQWQPQITGSSAPPPALGTQALPSLSPPAGAGLSLSDTESGQ
GSQEGGALSDSQIVELRRIPIADTHL
Download sequence
Identical sequences G5BN37
HGL_H00000384582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]