SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384597 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000384597
Domain Number - Region: 296-320
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0136
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384597
Sequence length 328
Comment GTF2A1L (Homo_sapiens) general transcription factor IIA, 1-like
Sequence
MTLQTASGNLYKVNEPIMVTQTSGRPSILQHPIQVFQQLGQPSIIQASVPQLNPCSLQAT
TEKSQRMEAMLQQSTILHSGSVDRKYLENATCDIFVPPGNEHGVLLEALLSRQENSQCLC
GSRVFPFQASPTGSGVEPVLSVPARVTQNLLGEPLSAETQGTLHHQVTDTQPHLLKIFMY
GGDSISQPREIEEPSRLPVSKKNSNSQVDLSSLLTDDINEIIQVGGTGDTSSNEEIKNIR
DVKENEFLGIIDAGDLKVLEEVDSISNEDSTANRSDNEDSQLNIVEEDPLNSGDDVSEQD
VADQFDTDNVIVCQYDKVLYSPFRLWVY
Download sequence
Identical sequences G5APM3
HGL_H00000384597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]