SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384614 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384614
Domain Number 1 Region: 56-465
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-83
Family Ras GEF 0.00092
Further Details:      
 
Domain Number 2 Region: 580-643
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000643
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384614
Domain Number - Region: 525-568
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00117
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.029
Further Details:      
 
Domain Number - Region: 471-500
Classification Level Classification E-value
Superfamily EF-hand 0.00286
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384614
Sequence length 702
Comment RASGRP4 (Homo_sapiens) RAS guanyl releasing protein 4
Sequence
MNRKDIKRKSHQECFRKAEGQDRPRQARRHKTCPSPQEISKAMASMNLGMLAEGSCSEDE
LMEKCIQSFDSAGSLRRGDHILNMVLAMHSWVLPSADLAARLLTSYPPRARSYGWREEGR
ILRAWEMGQGSRYWLSRHPEAVHQDPQLEDVIARFWATVTQKGNSAQKSLGDTSNLLSPG
GPGPPPPMNSPNLGKKCKVSLLFDHLKTDELAQHLTYLEFRSFQAITPQDLRGYVLQGSV
RGCPALEASVGLSNSVSRWVQVMVLSRPGPAHRAQVLDKFIHVAQSLHQLQNFNTLMAVT
GGLCHSAISRLKDSHAHLSPDSTKALLELTKLLASHNNYACYRRTWAGCTGFRLPVLGVH
LKDLVSLQEAQPDRLPDGRLQLSKLNSLYLRLQELAALQQQQPPCSASEDLLHLLTLSLD
LFYTEDEIYELSYAREPRCPKSMPPPPFRGLLVVEWAPGVTPRPDRVTLERHVEQLVESV
FKNYDPEGRGTISQEDFERLSGNFPFACCGLHPPPRPESGSFCREELTEYLLRATVICSK
LDLAFLHTFQEVTFRKPAFCHSCSGFVSALPSATEYLLRATVICSKLDLAFLHTFQEVTF
RKPAFCHSCSGFLWGVTKHGYRCQDCGLCCHKNCRDQVKAECKKRPGAKSDAGPLETPIP
PTPAPPASCGSEDNLSYTLSLEPETRCYLRPPWTQTEPPHPS
Download sequence
Identical sequences G5AMB4
HGL_H00000384614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]