SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384801 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384801
Domain Number 1 Region: 836-937
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-24
Family Ankyrin repeat 0.00000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384801
Sequence length 937
Comment C14orf135 (Homo_sapiens) Pecanex-like protein C14orf135 (Hepatitis C virus F protein-binding protein 2)(HCV F protein-binding protein 2)
Sequence
MPSRSLFPWVTRDLSTCDLSEVSNSPLIAPFLYKHFCARKGPEFTSVKSTLIESYPPGLG
NCSFLLPRLLVMFIISTGTAVTSYFIPSTVGVVLFMTGLGFLLSLNLSDPNFVFKHSMTR
NRVETKAQTSPRALERQFLWKEFLLHVIVLVLALLEASLLHHFAGFSQISKSSSQAVVGY
ILMLLLIILWILREIQSVFILGIFRNPFYPKDVLTVTVFLGKQAKLLRAGIVRRILLTLV
SPFAMIAFLSLDNSLQRLHSVSVSIGFTRAFRMVGIIRDRLIQFISKLQFAITVLLASWK
EKKQHRTTTTTLCILNVIFFPFVLVIIVFSTLLSSPLLPLFTLPVFLVGFPRPTRSWPGA
VGTAACVCEDTIYYDQMVPRLTAALQTAMAGGCLGLLLPGSHYLGRFQDRLIWIMILERG
YTYCCINIKGLELQETSCHTAEARTVDEIFEGAFEQEYSKVCSLNEHFGNVLTPCTILPV
KLYSDARNVLSGIIDSHENLKSFKGDLIKVLVFILLQYCSKRPSKQNFHKTESKGETSLI
VLPPSSCPRSPEDTHSFNSQTFNDWSDDIFDDEPTVQKGKNRLNDLPGTTIHLPGSVDSQ
KIDNLSTGTISENSLYKAVMLGYPAIDKGKQGSMAYISLTEFSSLHSHLVSLPEEWRSSC
VPNSRMKEMSSLFPEEWYQFVLSQLECFHSEMASAALEEISKDKVLKDFYVHTVMTCYFG
LLGIDNMVPTPGHILRVYGGVLPWSSALDWLTIKPELFQLALKAFRYTLKLMVDKASLGP
TEDFEALNSCLEEYESDWYIGLVSDEKWKEAVLQEKPCLFSLGYDPNMMSLVNLEKKLLA
AARKGQDDEVRTLMANGAPFITVWFATSPLHLVAQHGHYFTAEVLLHVGVSRDDLTKVDW
TPLHMAATDGHVHIRELLVRNSADVNAKDMLKMTALH
Download sequence
Identical sequences G5C5H3
HGL_H00000384801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]