SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385047 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385047
Domain Number 1 Region: 180-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000419
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 2 Region: 123-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000477
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385047
Sequence length 271
Comment ZCCHC9 (Homo_sapiens) zinc finger, CCHC domain containing 9
Sequence
MTRWARVTTTRSKKPLPATSWEDMKEGSLQGRSSHAPETQQPRASRLSLKNDRPQAKRKK
NKKKKEYLNEDVNGFMEYLRQNSQMVPSGQVITTDAREVRKEIAVALKKDSRREGRRLKR
QAAKKNTMVCFHCRKPGHGVADCPAALENQDMGTGICYRCGSTEHEITKCRAKVDPALGE
FPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKVCGSVEHLKKDCPENQRLDRVVTVGR
WAKGMSADYEEILDAPTVQKPKTKTPKVVNF
Download sequence
Identical sequences G5BK71
XP_004841681.1.39548 HGL_H00000385047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]