SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385099-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385099-2
Domain Number 1 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 478-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 59-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-16
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 9 Region: 561-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000854
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  HGL_H00000385099-2
Domain Number - Region: 177-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00102
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 128-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00193
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385099-2
Sequence length 457
Comment ZNF792 (Homo_sapiens) zinc finger protein 792
Sequence
MRMAEEMPGAEARNATLSRGQGRVRVGLSPREPPQSPAEKAPLGPEGLMAVSVQQDLVQH
GCVTFEDVTIYFSQEEWGLLSEAQRLLYCDVMLENFALIASLGLTSFRCHVIAQLEVGKE
PWVPDRVAMTSAMTRGAFGRPGSDFCCGTELKELPSEQNVSVQGISQDGNPKTSLSTQKT
YPHDTCGPHLKDILCLAEHQATRARQKPYMCEASRTGFKFNRNLPQQQVQKNADKPARKE
EGRASPGKTCSDHSSQKPSMCGEGREDFVATSGFVQSQVTPSVEEAHKNSEGALDFPSAQ
RHNKSSPSRDAFSATSTLVHQQRVHIGERPYECSKCGIFFSNASGLMQHQRVHNRGKPYE
CWFEEQEGRECLMIHAFYRIFLKTGLCGQMVANSIYEIQAALAKYGTMAELLQTDSIQVT
LLNSSSNLKLFLKTAEKYFMVGCQVKYYIFTDQPIFL
Download sequence
Identical sequences G5BXK6
HGL_H00000385099-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]