SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385213 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385213
Domain Number 1 Region: 37-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.06e-36
Family SCAN domain 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385213
Sequence length 801
Comment PGBD1 (Homo_sapiens) piggyBac transposable element derived 1
Sequence
MYEGLPGSISENEHSILKVKIEDTTCEQAYGSQEQSSRTQELCRLQFRQFCYQQAPGPRE
ALAQLRELCRQWLRPEMHSKEQILELLVLEQFLAVLPGELQAWVQMYPLQSGEEAVRVLE
NLAAGRGDTGQQASFYIQEQDMHLVVTDYQGASLESHSLQLLPRVTTLPSEPPQLPQEVS
GFAPQGPTFLQEESSREKAEEPECSPPWVQMSVKTEEEPAQASALVEWPRLSLAPRNLCG
NSAQETATGLMKMVTKGILFNVEQNTCEEIGPGVKTSEVPSRDCVPHIPCSAAVLPGKTA
LNFNNPVDRHPPRDSWARMHITSLEYAAGDITRKGRKKDKARVSELLQGLAFSDDSAVED
DNEPDTQPTQKKLKVVGTPKKRWTKRDLNPKFPCWSALDSGLLNLKSEKLNPVELFELFF
DDETFNLIVNETNNYASQKNVNLEVTVQEMRCVFGILLWSGFVGCSRMGMYWEISDADQN
LVRDAIRKDRFDLIFSYLHFADNNHLDQKDKFSKLRPLIRQMNKNFLLYAPLEEHYCFGK
SMCECFDTDQFLNGKPLRIGYKIWCGTTIQGYLVWFEPYQEESTLEADKDLDLGLGGNLV
MNFADVLLEKGQYPFHLCFDSFFTSTKLISALKKKGVRATGSIRENRTEKCPIMNAEHMK
KMKRGYFDFRVEENDEIILCRWHGNGIISLCSNAVGIEPVSGISGFTDDNEILQLSQPAI
VKLYEECRKGVSKMDQIISKYRVKLRSKKWYSILVSYMIDIAMNNAWHLHRVSNPGTSLD
FLEFRKCVAHFYLEHNTDLSD
Download sequence
Identical sequences G5BSG9
HGL_H00000385213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]