SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385255 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385255
Domain Number 1 Region: 1487-1617
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.99e-24
Family Synaptotagmin-like (S variant) 0.064
Further Details:      
 
Domain Number 2 Region: 408-550
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-20
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 3 Region: 968-1104
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.26e-18
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Domain Number 4 Region: 262-387
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-17
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 5 Region: 1706-1862,1889-1904
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000012
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 6 Region: 1135-1239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000357
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 
Domain Number 7 Region: 3-130
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000374
Family PLC-like (P variant) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385255
Sequence length 2007
Comment OTOF (Homo_sapiens) otoferlin
Sequence
MALLVHLKSVSELRGKGDRIAKVTFRGQPFYSRVLENCEDVADFDETTSVXXXPXXXFRW
PVASNIDRNEMLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENHVEVTDTLIDDNNAVIKT
SLNVEVRYQAADGTRGSWDDEDFLRDESLQEEEKDTQETDGLLPSSRPSSRPPGEKSFRR
AGRRVFSAMKLGKNRPHKEEPQRQDEPAVLEMEDLDHLAIRLGDGLDPDSASLASVTALT
TNVSNKRSKPDIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKE
STNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQPEH
QFHHKWAILSDPDDISAGLKGYVKCDIAVVAKGDNIKTPHKANETDEEDIEGNLLLPDGV
PAERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQ
KNSYEPLWNEQVVFTDLFPPLCKRMKVQIRDCDKVNDVAIGTHFIDLRKISNDGDKGFLP
TLGPAWVNMYGSTRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTE
VQVEQATPVSESCTGRVEEFFLFGAFLEASMIDRKNGDKPITFEVTIGNYGNEVDGLSGP
QRPRPRKEPGDEEEVDLIQNSSDDEGDDGGDLASVSSTPPVRPQITDRNYFHLPYLECKP
CIYIKSWWADQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSSG
CHRFLSLADKDQGHSYRTKLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRQCQN
FLQKLRFLADEPQHSIPDVFIWMMSNNKRAAYARVPSRDLLFSTVEEELGKDCAKVKTLF
LKLPGKRGFGAAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAARGLGLHSFPPL
SLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQM
LVFDNLELYGEAHELREDPPITVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFP
PQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLPPINAPVDTDRGPIMPVPVGIRPVL
SKYRVEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEV
DLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPEHTAPKWNTMVRLLWG
SSMLCNGGLFSHPPGEVVVSMEPEVPVRKLETMVKLDATSDAVVTVDVAEEEKEKRKKKK
GSAEEPEEEEPDESMLDWWSKYFASIDTMKEQLRQQETLGADLEEKEEADNTEGLKGPMK
GKEKARATKEEKKKRAQSPGPGQGSEVPEKKKPKIDELKVYPKELESEFDNFEDWLHTFN
LLRGKTQDGEDCSTEEERTVGRFKGSLCVYKVPLPEDISREAGYDPTFGMFQGIPSNDSI
NVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIQAS
FPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVAQTYSTHGYNVWRDPA
KPSQILTRLCKVGKVDGPHFGPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALSALRH
WEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPK
KYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFN
WRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELD
LNRFPRGAKTAKQCSMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAE
LHLLTAEEAEKNPVGLARSEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKVV
LALLGLLMLGLFLYSLPGYMVKKLLGA
Download sequence
Identical sequences HGL_H00000385255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]