SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385335 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385335
Domain Number 1 Region: 277-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 139-225
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.12e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 52-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385335
Sequence length 443
Comment PCBP4 (Homo_sapiens) poly(rC) binding protein 4
Sequence
MTLDKLIALSKQDPCSLARASQATAWTHSQATVAPAPPDRMSSSDAGLEEEPELSITLTL
RMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTAAVFHAVSMIA
FKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD
LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFS
VQGQYGAVTPAEVTKLQQLSGHAVPFASPSVVPGLDPSAQTSSQEFLVPNDLIGCVIGRQ
GSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTP
GSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGLKPVPFLALPPASPGPPPGLA
AYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences G5AXN5
HGL_H00000385335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]