SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385607 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385607
Domain Number 1 Region: 41-137
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-29
Family SH2 domain 0.00000484
Further Details:      
 
Domain Number 2 Region: 265-324
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.0000358
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000031
Family SH3-domain 0.00041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000385607
Domain Number - Region: 188-228
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0706
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385607
Sequence length 327
Comment GRAP2 (Homo_sapiens) GRB2-related adaptor protein 2
Sequence
MEAVAKFDFMASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHENDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISKQKQIFLRDRTREDQGHRGNSLDRRPQEGPHLSGAVGEEIRP
SMNRKLSDHPPPPPSQSHQHQQLPQHFTPGPQPLPQQRYLHHQHFNQDRRGGSLDINDRH
CGMGVGSEMSAVLMHRRHTDPVQLQVAGRVRWARALYDFEALEEDELGFRSGEVVEVLDS
TNPSWWTGRLNNKLGLFPANYVAPMMR
Download sequence
Identical sequences G5AYW0
HGL_H00000385607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]