SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385610 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385610
Domain Number 1 Region: 82-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 364-412
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000101
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 10-59
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385610
Sequence length 417
Comment MEX3C (Homo_sapiens) mex-3 homolog C (C. elegans)
Sequence
MKTNLERLSGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSM
IRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVT
PSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLG
SAWLSSNPIPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGD
TLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTP
RLSPTFPESIEHPLARRVRSDPPGTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPES
RRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences G5BVT3
HGL_H00000385610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]