SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385642 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385642
Domain Number 1 Region: 308-405
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000506
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 140-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000406
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 57-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000103
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385642
Sequence length 863
Comment AHR (Homo_sapiens) aryl hydrocarbon receptor
Sequence
MHKNVGHKTFRQKIIQKPTANSEVDPTGEPKAIWQCLAALHRVKPIPAEGIKSNPSKRHR
DRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSADRNGGQDNR
RAWFRDGLDLQEGEFFLQALNGFVLAVTTDALVFYASSTIQDYLGFQQSDVIHQSVYEFI
HTEDRAEFQHQLHWAFNSQDTDSGQAIHEPHGLSQPGVSYIPDQIPPENSSFMERCFICR
LRCLLDNSSGFLAMKFQGRLKYLHGQNKKGKDGSILPPQLALFAIATPLQSPSILEIRTK
NLIFRTKHKLDFTPIGCDAKAQIVLGYTEAELCSRGSGYQFVHAGDMLYCAESHIRMMKT
GESGMTVFRLLLKHNRWAWIQSNARVVYKNGRPDYIIATVRALTDEEGREHLQKRNMSFP
FMFTTGEAVLYETSNTFPPMMDPLPIRTKSSTSGQDSATKSTENKDSLHPSSLLAAVMPQ
DESIYHYPASNTAPFQTNFFNDSVIECSNWQENIVPLGCDNIPKHRQIGQSQEMNPVFSG
SHAGPFPDNKNSELYSIMKNLGIDFEDIKRMQNEEFFRTDMSGEVDFRDIDIRDEILTYV
QDSLSKSSFLSSEYEQQQAVTLNSSCMVQEQLELEQQQLQHHEKQIVVEAQQQLCQKMKH
MQVNGLLRNWSSNPSMPFSCPQQDLQQYSVFPDLNGENPEFPCKSELDTMPYTQNIVPCD
QSVLPQHSKCTQLEFPIGNFEPSLYPTTSNVEDFVTCLQVSENQRHGINLQSTIVTPQTC
YTGAMSTYQCQPEPQHTHVDQMQYNPAIPGPQAFVNKNGGVLNDMYPAQLSNISNTQTAT
HLQPLHHPAETRPFPDLTPSGFL
Download sequence
Identical sequences G5BZI5
HGL_H00000385642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]