SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385724 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385724
Domain Number 1 Region: 406-639
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 34-175,224-295
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 1124-1192,1244-1398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 835-955,995-1073
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-25
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000385724
Domain Number - Region: 782-834
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000118
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number - Region: 1403-1550
Classification Level Classification E-value
Superfamily EF-hand 0.0195
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385724
Sequence length 2060
Comment CACNA1C (Homo_sapiens) calcium channel, voltage-dependent, L type, alpha 1C subunit
Sequence
MQLHNRVREVALSSSGIWKQFGMGFNSMQDFNRPDGKNIAKERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTC
YNQEGIADVPAEEDPSPCALESGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQ
CITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKAR
GDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTEN
VAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNT
LTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCG
GILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLL
FLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMA
YGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKL
ARTASPEKKQEAVEKPAVEETKEEKIELKSITADGESPPTKINVDDLQHNENEDKSPYPN
PDAAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVND
TIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTAIFTIEIALKILGNADYV
FTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCS
DSSKQTEAECKGNYITYKDGEVDQPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPE
LLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIHYGQSCLFKI
AMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCD
AWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLS
RGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQT
FPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYM
LCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLL
RRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQA
NEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVG
KPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGG
LFGNHVSYYQSDSRSTFPQTFTTQRPLHINKAGSNQGDTESPSHEKLVDSTFTPSSYSST
GSNANINNANNTALGRFPHPAGYASTVSTVEGHGPPSSPAAWAQETTRKLGTMRCHSRES
QIAVVCQEEASQDKTYDVELNENAEYRSEPTLLSTEMLTYQDDENRQLTPPEEDKRDTRP
SPKRGFLRSASLGRRASFHLECLKRQKNHGGDISQKTVLPLHLVHHQALAVAGLSPLLQR
SHSPTTFPRPSATPPATPASRAWAPQPIPTLRLEGAESSEKLNSSFPSIHCSSWSEDASP
CGGGSSTARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVAT
QELADACDMTIEEMENAADNILSGGGPQSPNGTLLPFVNCRDPGQDRAGGGDEDEGCARA
LGRGRSEEELADSRVHVRSL
Download sequence
Identical sequences G5AQP4
HGL_H00000385724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]