SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385834-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385834-1
Domain Number 1 Region: 354-694
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.06e-137
Family Transferrin 0.0000000000918
Further Details:      
 
Domain Number 2 Region: 23-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.15e-121
Family Transferrin 0.0000000000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385834-1
Sequence length 695
Comment TF (Homo_sapiens) transferrin
Sequence
MRIALSTLLACAALGLCLAVPEKTVRWCAVLDHEASKCASFRDNMKKVLPADGPRIICVK
KNSHLDCIKSIVASEADAVTVDAGLVHEAGLAPNNLKPVVAEFYGSQENPQTFYFAVAVV
KKDTNFQLSQLQGKKSCHTGLGRSAGWNIPIGLLFCDLPEPRKPLEKAVASFFSGSCVPC
ADGAAFPQLCQLCPGCGCSSLQPYFGYAGAFKCLKDGGGDVAFVKHLTIFEVLPQKADRD
QYELLCPDNTRRPVDEYAQCYLAKVPSHAVVARSVDGKEDLIWELLSQAQEHFGRDKSKE
FHLFSSSHGKDLLFKDSAQGFLRIPPRMDYRLYLGYPYITAIRNLREGICPESSQEEAKT
LKWCALSHHERHKCDEWSVKSDGKIECESAETTEDCIAKIMSGEADAMSLDGGFVYIAGQ
CGLVPVMAENYESSSCQGPPEKGYFGVAVVKKSDPDINWNNLEGKKSCHTAVDRTAGWNI
PMGLLYSRINHCRFDEFFSQGCAPGSIKNSSLCKLCIGPNVCAPNNKEVYYGYTGAFRCL
VEKGDVAFVKHKTVMQNTDGNNPDSWASNLKKDDFELLCPDGSRKSVDEYEKCHLARAPN
HAVVARKDKAEYVREVLVKQQSQFGSHVSDCTSQFCLFRSKTKDLLFRDDTKCLVRVENS
VTPEKYLGEEYVKAVGNLKKCSTSRLLEACTFHKL
Download sequence
Identical sequences G5BQA9
HGL_H00000385834-1 XP_004834311.2.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]