SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385834-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385834-2
Domain Number 1 Region: 293-641
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.44e-133
Family Transferrin 0.00000000103
Further Details:      
 
Domain Number 2 Region: 2-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-110
Family Transferrin 0.00000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385834-2
Sequence length 642
Comment TF (Homo_sapiens) transferrin
Sequence
MKTTSYRECIRAIMANKADAVTIDGGLVFEAGWPPYNLKPIAAEFYGSKDDPQTHYYVVA
LVKKGTDFQLNQLQGKKSCHTGLGWSAGWIVPIGLLLPSGSLEAGAAKFFSGSCVPCADA
KKFPSLCQLCAGKGTDKCACSSHEPYFGYSGAFKCLEDSVGDVSFVRHLTVFEVLPQKAD
RDQYELLCPDNTRRPVDEYAQCYLAKVPSHAVVARSVDGKEDLIWKLLSQAQKYFGKDKS
SEFQLFSSPHGKDLLFTNAAHGFLRVPPKMDAKLYLGYEYFSAIQHVERGVEDSRRVQWC
AVGHHERAKCDEWSALSGGALVCTTEEIPEDCIAAIMKGEADAMSLDGGFVYTAGQCGLV
PVLGENYGAKGSNERLASKCVNSALEGYSVVAVVKKSDADITWNSLQGKKSCHTAVGTSA
GWNIPMGLIYNKTRSCKFDEFFSHSCAPGANPDSQLCALCGGSSNPSHMCAPNSHERYYG
SSGALRCLVEKGDVAFVKPSAVLQNTNGKNPEVWAKDLKQEDFELLCLDGTRKPVTEAQS
CHLAIVPNHAVISRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSTKDLLFSDDTEC
LANLGNKTTYEKFLGPEYLSAMANLRPCLNSELLDVCLFHRN
Download sequence
Identical sequences G5BQB0
HGL_H00000385834-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]