SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385887 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385887
Domain Number 1 Region: 37-146
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.57e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 551-636,677-746
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.8e-20
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 308-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000218
Family Ankyrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 897-945
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000663
Family MYND zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385887
Sequence length 948
Comment ANKMY1 (Homo_sapiens) ankyrin repeat and MYND domain containing 1
Sequence
SLLSSRDSSVSPAEEDEESEGPLSGRGLKEASIQLVHGVQTWRDGCVYRGEFGLNVKLGY
GEFSWPTGETYRGQFYRDHCHGLGTYVWPDGSSFTGTFYLSHREGYGSMNLKTRLFQGLY
KADIRFGPGIETYPDGSQDVGLWFRTHLIKLVTKTASSFSVLSYPEFSAFLTCSRERISL
SDEEGVEWGPLEGQDPFFYEYKRFLLSDSLTLPPEMQAYSTDHCHLPMTSSFRRELDARI
FLDDIPPFVDDGEPWFTANKTPLLVKIQKQAYKFRNKKAHTSWNMGAILEGDRGGFAGIG
PKEQFSQELILKAEEGDHDRVYGILKDNLAYADVADAKGYTVLAAAAVHCHNDIVNLLLD
HGANVNKFTDEGLTPLNMCFLLYYPSESFKPNVAERTVPQENPKPLFTPKPSPSCVETHV
ESTYEVVTSSPGSGEQKPPSCTSGSQEDGSAPGTQQSLESESSSPSGQGTVSDRERGLEG
LPGGLDVSPPCSEAHFESDLCVRSYSIQLSRDMLEKSAQAYSMLQVPGAPDKGTVRSMAW
SMVKRRCRWLTIKLLLHRGADPNLCCVPMRALFFAVKAGDVDGVRVLLESGARTDIRYPP
QLGALTPLHIAAALPGEEGVRITELLLHAITDVDAKAADQDDVYKPGKLDLLPSSLKLNN
EPGPPSTYYTASTCVAEEGGRTALHVACEREDSHQCARDVVRLLLSHGASPNLLWSGHSP
LSLSIASGNDLVVEELLSCGADPNLPLTRGLGSALCVVCDLAYEQQRSTDNKITLVDRLL
NHGADILKPVTLTQGDRVAVGTVVDYGYFKFFQDRKIAHCPFHVLLPAERETFLARKRLL
EYMGSQLRLAVLAREREWDRKAMSRSRKAELCPGHTMKKRSLGLAKALAAEGQELMPFFK
FCYQCGRSIGVRLTPCARCYGILTCSKHCKSKAWAEFHKRDCREMMAM
Download sequence
Identical sequences G5BGX3
HGL_H00000385887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]