SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386096 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386096
Domain Number 1 Region: 513-1330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-160
Family Motor proteins 0.000000539
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386096
Domain Number - Region: 1378-1523
Classification Level Classification E-value
Superfamily Tropomyosin 0.000196
Family Tropomyosin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386096
Sequence length 2536
Comment MYO18B (Homo_sapiens) myosin XVIIIB
Sequence
MPIREEDKSPPPSSPPPLFSVIPGGFIRQLVRETEKESKEARRRKEAVLASPEQETPEVS
VNQSNSKTNSGTKSGSQQTSGDSQSTSLQGTSIPGKDNQHSGTADPALMTSVNGERHQEP
GPGGIPARKALPFKKTVRRGDVLLMVAKLDPEATKPEHRNQAHDTPTCKTPPAATDPGGA
KEGETPGTSGPQASTEDLASKPEKTLTGGHGDPGQGMKGEKGQGTGPKGGEPKDKEEQRT
RPQSRGAGDGGQLGTVEKEGGDPPTKMEKRNESKDMGAEGKHAGPRVQGKKWGEFLSRSK
WDGPQSKKDRESELPGMAEKTGKPQAKMEERGKVQGKAGQAGEALQTLGKAAEPGKASEA
PKSEEVGQPQRKAAGTGRAGSQADKGCKVPKEVAIERVSPAVTEPEDRPESRAQRAEKPC
TKVEDAAGGPEPQQEGCAEPSLETRVEKPPGQTQAQEGPTLQDQGRGGHSGGLGQAHEDR
WYEAEKVWLVQKDGFTLATVLKPDEGTADLPAGRVRLCIDADKTVTEVDEEHVHRANPPE
LDYVDDLASLVSVNESSILNTLLQRARAQLLQTCAGPDLIVLQPQGSMAPSSGKVPRSRR
DGLPAHVSSLAQRAYWAMLSQRRDQSIIALGRSGAGKTTCCEQVLEHLVGMAGCVDGRVS
VEKIQATFTILRAFGSVCTGHSCSATRLAMVMSLDFNATGRVTAAQLQTMLLEKSRVVRP
LEGEGNFPVFSQMLAGLDLDLRTELYLYQMADSSSFGMGMWSKPEDKQKDVAAFAQLQGA
METLGITEGEQRAIWRVLAAIYHLGAAGACKVGRKQFMRFEWANHAAEALGCEYEELNTA
TFKHHLRQIIAQVTTGPSRRGLKDEEPSSGFKMTGTECVEGMASGLYQELFVAVVSLINR
SFSSHHLSMASIMVVDSPGFQNPRHQGKDRAATFEELCHNYIHERLQLLFYQRTFISVLE
RYQEVRLPTGGRTEDARGLFWVLDEEVQAEGSEDSVVLERLRTAFEKKGAGAKGTSALRT
CEQPLQCEIFHQLGQDPVRYDLTGWLHRAKPNFSALDAPQLLQQSKREELQSLFQGRAKL
PPVCQAVAGLEGTSQQALHRSRVVRRTFTSSLASTRRRAPCSQIKLQMDALISLVRRSQL
HFIHCLVPTPALDNKGGQESSAPPLPGDQQEASKPLAPDIPALRVQLVGSHILEALRLHR
TGYADHMGLSQFRRCFQVLDPALLKKFMSVPEGIDERKAVEELLETLDLEKKVVAMGHSQ
VFLKAGVVSRLEKQREKLVSQNIILFQAVCRGFLSRQEFKKLKIRRLAAQCIQKNVAMFL
ALKDWPWWQLLGSLRPLLSATVGNEQLRAKEIADLTTELADERFKGDVACQVLENVCAER
LQASREVQELRNKYEQVQKNLGEVERQLEEAQQKIQLNDLERKHTGGADEWQMRLDCAQM
ENEFLRKRLQQSEERLDSELTSRKELEQKLGELQSAYEEAKKTAHQLKRKSHRLTWDLED
TRVLLETQQSQNHELEKKQKKFDMQLAQALGESVFERSLREKAIQESSSMRWELGQLQEQ
LEQKEQETLRLKQEVEMLQKHKQELLASPSLGASGVASLKERLWKLESSAQEHEKVQNQQ
ENTIKQLEQLRQRFELEIERMKQMHQKDREDQEEELEDVRQSCQKRLRQLEMQLEQEYEE
KQMVLHEKQDLEGLIGSLCDQIGHRDFDVEKRLRRDLRRTHALLSDVQLLLVTVDDGKTS
VSKEELEKVHSQLKQSEAKCEDALKTQKALTLDLESMHSELENMTRSKSLVDEQLYRLQF
ERADLLKHIDEDQDDLNDLMQKHKDLIAQSAADIGQIQELQLQLEEAKKEKHKLQEQLQV
AQMRIEYLEQSTVDRAIVSRQEAVICDLENKTEFQKVQIKRLEVLVIRLRDSLIKMGEEL
SQAVASESQQRESSQYYQRRLEELKVDMEELLQREAEASRRCMELEKYVEELGAVRQTLQ
TDLETSIRRIADLQAALEEVASSDSDTERDNVSIISSQPDGNLQSWLSCTLSMATDTMRT
PSRQSATSSCIRSSRAELMEYNGETEVLGQVQNQVGGRQGPWRSEQVDKGTVKINFKGAG
GRWKGGSQHRNRKCKLQKQYSLILTQEQQSNVKMNAEAGDAESRTWDAHGKTSRDYSVSP
CSTRQRKSCHFGGCEEFGVQRKPMERSGALSTREASRSPDTSPLPREKLPSPSAALSEFV
EGLRRKRAQRGQGSSLGLEDWPTLPIYQTTSTSRLRRGRAGSDEGDLSLRLQAKSPLGEE
GSPGTPAGLLRSTSLKCISLGVAEGTSLAPERLKTRFSSCESLLESEPSVRRKTSSPTTP
RNTLLSPTLRPRRRCLESSVDDAGCPDLGKEPLVFQNRQFAHLMEEPLGSDPCSWMLPSL
SYGRKARVDFDDFLPAIRKPEMPTSLAGAAKDGHEGSKHSGVLFETEEADRSFLSGIKTI
LKKSAESREDPAHLSDSSSSSSSIVSFKSAGSIKSQPRSPRLEVSGGERMSAENRESGTG
RKDDDVESIMKKYLPK
Download sequence
Identical sequences G5BGN6
HGL_H00000386096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]