SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386135 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386135
Domain Number 1 Region: 457-784
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-74
Family Ankyrin repeat 0.0000165
Further Details:      
 
Domain Number 2 Region: 216-402
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-45
Family Protein kinases, catalytic subunit 0.0000000307
Further Details:      
 
Domain Number 3 Region: 1469-1559
Classification Level Classification E-value
Superfamily DEATH domain 2.94e-17
Family DEATH domain, DD 0.0039
Further Details:      
 
Domain Number 4 Region: 69-145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000019
Family Protein kinases, catalytic subunit 0.0000279
Further Details:      
 
Domain Number 5 Region: 840-876,952-1032
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000175
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386135
Sequence length 1597
Comment DAPK1 (Homo_sapiens) death-associated protein kinase 1
Sequence
MFITSQGGDLYIKRNAHKVSTATGLMRNDNNQKFPPVHACPWIATSTLSSGVELTGNARE
KAYAQVQDRGQFAVVKKCREKSTGVQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQ
HPNVITLHEVYESKTDVILILELVQWLGDNCSYQALREGFRRRGVRASWPVKDLFSVSLL
PCLTGRSDHRACEVPEVEPQRESGKVTALKGTCISVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHTLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMCLSGASPFLGDTKQETLANVSAVNYEFEEEYFSNTSALAK
DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSV
RLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLSN
YDVNQPNKHGTPPLLIAAGCGNIQILQLLLKRGSRIDVQDKGGSNAVYWASRHGHVDTLK
FLNENKCPLDVTDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEETPLHCAAWHG
YYSVARALCEAGCNVNIKNREGETPLLTASARGYHDIVVGVMGYHDIVECLAEHGADLNA
SDKDEHIALHLAVRRCQMEVIKTLINQGCLVDFQDRHGNTPLHVACKDGNVPIVVALCEA
DCTLDVSNKYGRTPLHLAANNGILDVVRHLCLMGANVDALTSDGKTAEDLAKSEQHEHVA
GLLTRLRKLIPALPCSGISTCADEGETTESCWEFSCAEMLHVLGRSMMGLPGDEDTHRGL
FIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSTRFPP
SPLAAKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPSHHLHCSTDDQST
KAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAVNDPTSIHVIVFSLEEPYEIQLNQV
IFWLSFLKSLVPAEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGGEFGYDKDMSLLKD
IRNRFGNDLHITNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCPPMTHLCEKIISTL
PSWRKLNGPNQLMSLQQFVYDVRDQLNPLASEEDLRRIAHQLHSTGEINIMQSETVQDVL
LLDPRWLCTNVLGKLLSVDTPRALHHYRGRYTMEDVQRLVPDSDVEELLQILDAMDICAR
DLSSGTMVDIPALIKTDNLQRSWADEEDDAMVYGGVRIVPVEHLTPFPCGIFHKVQVNLC
RWIHQQSTEGDADIRLWVSGCKVTNRGAELLVLHVNHGQGIEVQVRGLETEKIKCCLLLD
SVCSTIENVMTTTLPGLLTVKHYLSPQQLREHHEPIMVYQPRDFFRAQTLKESSLTNTMG
GYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPPDPMGKDWCLLAMN
LGLPDLVAKYNTNTGAPGDFLPSPVHAVLQEWTSYPESTVGILVSKLRELGRRDAADFLL
KASSVFKINLDGSGQEAYASSCNSGTSYNSISSVVSR
Download sequence
Identical sequences G5ARM1
HGL_H00000386135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]