SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386226 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386226
Domain Number 1 Region: 280-368
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.99e-26
Family Canonical RBD 0.0012
Further Details:      
 
Domain Number 2 Region: 171-279
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000121
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386226
Sequence length 428
Comment RBM34 (Homo_sapiens) RNA binding motif protein 34
Sequence
MALEAGNKRKKKRSAKQREDPGLGADGDASRDYLIGQVAKSLLRGRPPPRACAGRLASLF
SASAPQVRPVYVPVSQETSKKRKCDEEEENTSLIQRPLLQERAKKVKKELSDADKLASRE
TALASADLEEEILQKQGQKGKKSRSSVKVAYRKVLDDVGHNFDASQRKKIPVNQEEERLK
NERTLFVGNLPITCNKKKLKSFFKEYGQIESVRFRSLIPAEGTVSKKLAAIKRKIHPDQK
NINAYVVFKEESAATKALKRNGAQIADGFRIRVDLASETSSRDKRSVFIGNLPYKVEETA
VEEHFLDCGSIVAVRIVRDPVTGVGKGFGYVLFENTDAVHLALKLNNSELMGRKLRVMHS
VNKEKLKQQSSNPGLKNVSKSKQRFNFASKDVGQSKSVFIGEKAVLFTKKKKKGQKKSGR
TKNVTKQK
Download sequence
Identical sequences G5AKC2
HGL_H00000386226 XP_004854682.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]