SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386227 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000386227
Domain Number - Region: 84-227
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.0088
Further Details:      
 
Domain Number - Region: 501-567
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.00163
Family Double Clp-N motif 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386227
Sequence length 887
Comment MCC (Homo_sapiens) mutated in colorectal cancers
Sequence
MAKPGPAGKLGTGTVAVGHWCSLVRPAALGGAWWSQTWVDSAEEVIPQPHLCAGTFGTLK
MKRFSEYSPRKMNKVLHLAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLM
REHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREEDEYSELRSELSQSQHEV
NEDSRSMDQDQTSVSVPENQSTMVTADMDNCSDLNSELQRVLTGLESVVCGRKKSSCSLS
VAEVDRHIEQLTTASEHCDLAIKGTDLAMFCRQLKRSRGCLAGTCTPRWEKELAGLREEN
ESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSSPGRLTSAT
RPVNPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSEISSIGVSSSVAE
HLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNSRIEHLKSQNDLLTITLE
ECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESEQSLILGQFRAAGV
GSSPGDQSGDENITQMLKRAHDCRKTAENAAKALLIKLDGSCGGAFAMAGCSVQPWESLS
SNSHTSTTSSTGSSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSYDV
KPRGDSQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLV
HIEHLKSEVEEQKEQQMRSLSSTSSGSKDKAGKECAEAASPALPLVELRTSCSESELASE
FAGAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKK
HQNKLKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL
Download sequence
Identical sequences G5BA97
HGL_H00000386227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]