SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386251 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386251
Domain Number 1 Region: 145-332
Classification Level Classification E-value
Superfamily E set domains 1.45e-52
Family Cytoplasmic domain of inward rectifier potassium channel 0.00026
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.2e-24
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386251
Sequence length 360
Comment KCNJ13 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 13
Sequence
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILIDMRWRWMMLVF
SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH
IDGKPNLIFQVANTRPSPLTSVRVSAVLYQERESGELLQTSVDFHLDGISSEECPFFIFP
LTYHHSITPSSPLATLLQHENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQVKMENFDKTVPELPTPLVSKSPHRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences A0A0P6JEG4
XP_004868131.1.39548 HGL_H00000386251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]