SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386337 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386337
Domain Number 1 Region: 493-595
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000571
Family Ankyrin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386337
Domain Number - Region: 69-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00408
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386337
Sequence length 728
Comment ANKZF1 (Homo_sapiens) ankyrin repeat and zinc finger domain containing 1
Sequence
MSPAPDAPPAPTSVSLFDLSAEAPVLRGLSLVSQAPGKALARPLPTSCPGSGQKESPERK
VIQGPLDISEKLFCSACNQSFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSC
TGELSSISGSEDSDSASEENLQTLGKERAECEGPNRPRSFCPHRVLFQNAQGQFLHAYRC
VLGPHQASDITDEAKLLLQSLQNGGPRHYVVLMAAAGHFAGAIFQGREVVMHKTFHRYTV
RAKRGTAQGLWDAQGRPSRSAGANLRRYNEATLHKDVRDLLTGPGWAEALEQAQTVLLRA
PHSGRSMFFGGHRAPLQREDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYGEDFWETVR
LHSPQAHRKTVRKERKKPIEEERKRVLSDENEALGQNEESPKQGSETEDEHGAQVELELV
ELTLGTLDLREFELLPKRRRRKRNKKEKAQDQDAGAHVTLNQQHQEDEPTSQLAQVVAAP
LGSSADEAKAPGQLELWDVLLAACRAGDIRKLRLQLTAGAVDPEVMSLLNAPLGSGGFTL
LHAAAAAGRGSVVWLLLEAGADPAVQDSQARPPYTVAADRATRNEFRRFMEKNPDAYDYD
KAKVPGPLTPEMEAQRATRKREQKAARRQREEQQQKQQEQKEREQEEQRRFTALSDREKR
ALAAERRLAAQLGVPAPPIADSQVASAWRCWNCGASLQALIPFHYLDFSFCSTRCLQDHR
SRAGKPFS
Download sequence
Identical sequences G5AKK1
HGL_H00000386337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]