SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386367 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386367
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.11e-85
Family Integrin A (or I) domain 0.0000000467
Further Details:      
 
Domain Number 2 Region: 372-458
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-24
Family Integrin domains 0.00034
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.75e-17
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000732
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Integrin beta EGF-like domains 0.0013
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000126
Family Integrin domains 0.002
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386367
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386367
Sequence length 787
Comment ITGB6 (Homo_sapiens) integrin, beta 6
Sequence
MGIELLCFFFLFLGRDDCVQGGCAMGGAETCGDCLLTGPQCAWCSQENFTHPSGVSERCD
TPANLLAKGCQLIFIENPVSQVEILKNKPLSVGRQKNSSDIVQIVPQSLILKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMNDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PISPFMKTTPEEIANPCSSIPYSCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDNKNE
YSMSTVMEYPTIGQLIDKLVQNNVLLIFAVTQEQVPLYENYAKLIPGTTVGLLHKDSGNI
LQLIISAYDELRSEVELEVLGDTEGLNLSFTAVCSNGTLFPHQKKCLHMKVGETASFNVT
VSIPNCERKGRHIIIKPVGLGDTLDLLVSPECSCDCQKEVEVNSSKCHDGNGSFQCGVCT
CNPGHMGPHCECGEDMLSTDSCKEAPDRPSCSGRGDCYCGQCICHLSPYGSVYGPYCQCD
NFSCVRHKGLLCGDNGDCECGECVCRSGWTGEYCNCTSSTDACISEDGLLCSGRGDCNCG
ECVCTDPGASGATCERCPTCSDPCNSKRSCIECHLSADSQPGEECADKCKLAGVTISEEE
DFSKDSTVSCSLQGENECLITFLISTDNKGSTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KTDLSTD
Download sequence
Identical sequences G5C005
HGL_H00000386367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]