SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386464 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386464
Domain Number 1 Region: 178-317
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-33
Family C-type lectin domain 0.00082
Further Details:      
 
Domain Number 2 Region: 318-456
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-32
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 3 Region: 1339-1481
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-28
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 4 Region: 917-1061
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-27
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 5 Region: 1073-1191
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-26
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1504-1628
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-26
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 7 Region: 602-763
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-25
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 2-123
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.72e-25
Family Cysteine rich domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1630-1761
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-23
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 10 Region: 469-593
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-19
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 11 Region: 1205-1325
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-17
Family C-type lectin domain 0.0049
Further Details:      
 
Domain Number 12 Region: 122-178
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000014
Family Fibronectin type II module 0.0025
Further Details:      
 
Domain Number 13 Region: 766-900
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000108
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386464
Sequence length 1839
Comment LY75 (Homo_sapiens) lymphocyte antigen 75
Sequence
NDLFTIVNENTGKCIKPLYQWIVAKDCDETKDMLWKWVSQHRLFHLQSQKCLGLDITKPM
DTLRMFSCDSNAMLWWKCDHHSLYSASQYRLALEDGYAIASTNTSDAWKKGGSEESLCDQ
PYHEIYTRDGNSYGRPCEFPFLVHGTWHHDCILDEDHSGPWCATTLNYEYDQKWGICLKP
ENGCEGNWEKNEKTGSCYQFNTQAVLSWKEAYVSCQSQEADLLSINNAAELTYLKGKEDI
AKIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDMPSAPIIGGSSCAKMDAESGLWQMIFC
EAKLPYICEKPLNNTTEFTDVWTYSVTRCDAGWLPNNGFCYVLVNESGSWDEAHTKCKAF
SGDLMSIHSLADVEMIVTKLHNGDTQEEIWTGLKNINTPTLFQWSDGTEVTLTYWDENEP
KVPYNKTHNCVSYIGKLGQWKVQSCEEKLKYVCKKKGEKMNDTKSDNMCLLDEGWKRHGE
TCYKIYKDEVPFGTNCNLTITNRFEQEYLNDMMKKYDKSLQKYFWTGLRDVDSHGEYSWA
TAGGIKQAVTFSNWNFLEPASSGGCVAMSTGKSLGKWEVKDCRNFRALSICKKISGPLEP
EQAAPKPHGPCPQGWHTFPSSLSCYKVFHIERVMRKRNWEEAERFCQALGAHLPSFSHMN
EIKEFLHLLKEQFSVHRWLWIGLNKRSPYLQGSWQWSDHTPVSTIIMENEFLEDYNIRDC
AAVKVIYSSWRRGWHFYDDREFIYLRPFACDTKLEWVCQIPKGSTPKTPEWYNPERAGIH
GPPVIIEGSEYWFVADLHLNYEEAVLYCASNHSFLATVTSYTGLKAIKNKIANISDEEQK
WWVRTNGQPIDHHFIYSRHPWRRFPMTFGEECLHMSAKTWFIDLSKPIDCRTKLPFICEK
YNVSSLEKYSPSSAAKVQCSEPWIPFQNKCFLKIKSKSLTFSQANDLCLSYGGTLPSVLT
QSEQDFITSLLPSMEANLWIGLRWTAYEKIGKWMDNRELTYSNFHPLLVSWRLRIPASLF
DEDSHYHCALMLNLPMSPFTGTWNFTSCAERHFVSLCQKYSEVKDRQPLPNTSETIKYLN
NLYKIIPKTLTWYSAQRECEKENMRLVTITNTYQQAFLTVQVVLWNSSFWIGLFSQDDER
NFGWLDGKRLHFSRWDENSEQLEDCVILDTDGFWKTADCNDNQSGAICYYPGNETEVKPI
EGVKCPSPILNTPWIPFQNSCYNFMLTKNRHIAMTQDEVHSKCQKLNSRSHILNIRDEKE
NEFVLEQLLHFNYMASWVMLGIIYENNSLMWFDKTMPSYTHWRAGRPTVKNSKFLAGLST
DGFWDIQTFNVIDEILPFHQHTILACKIEMVDYKEEYNTTLPQFIPYEDGLYNVIQRKVT
WYEALNTCSQSGGHLASVHNQNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSAL
DYIPWKSQKSPGNCVVLDPKGIWEHETCNSVKDGAICYKSTKSKELSLHTYSSRCPAAKE
HRSQWIQYGDHCYTTDQTLHSFSEAKQLCQELDHSATIISIKDENENKFVSRLMRENNNI
TMRVWLGLFQHSLDHSWSWFDGSGVTFVKWENKSKSGDGKCSILLASNETWKKVECSHGY
GRVVCKVPLGCPSSTWVQFQDSCYIFLQEAVKVEGIEDVRNQCTGHGADMISIHNEEENA
FILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDNWADQEDGDNLVDTCGFLHT
KTGEWKKGNCEVSSVEGTLCKAAIPYDKKYLSDNHILISTLVAASTVILTVLGAIIWFFY
KRHSDSGFTTVFSTTSQSPFNDDCVLVAGEENEYAIQFD
Download sequence
Identical sequences G5C003
HGL_H00000386464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]