SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386502 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386502
Domain Number 1 Region: 9-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.99e-53
Family Ankyrin repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386502
Sequence length 186
Comment ANKRD61 (Homo_sapiens) ankyrin repeat domain 61
Sequence
MGIPFMPSLVQAIFNGDSDEVQALIFKKEDVNFQDNEKRTPLHAAAYLEDAEIIELLILS
GARVNAKDSKWLTPLHTAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCA
EALVSLLSNVNVSDRAGRTALHHAAFSGHGEIVKLLLSRGANINAFDKKDRRAIHWAAYM
GMYFLS
Download sequence
Identical sequences G5C2B9
HGL_H00000386502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]