SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386532 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386532
Domain Number 1 Region: 44-161
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-16
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 219-265
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000034
Family SOCS box-like 0.0045
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386532
Domain Number - Region: 131-219
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 0.0859
Family Cofactor-dependent phosphoglycerate mutase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386532
Sequence length 270
Comment ASB18 (Homo_sapiens) ankyrin repeat and SOCS box-containing 18
Sequence
MDRFFQDPNVVFEISTDEVEWRVKSPAAFGLSGLWTLEYKRELTSPLRVAAAHGHAACVR
DLLRRGANPNASPGARGALHEACLGGHTACAHLLLQHRADPDLPSAEGLAPLHLCWTTAS
LGAGALDYGGASPLSRALQTAACAPPATAQRTVQALLNHGSPTVWPEAIPKVLRTCAQVP
AVIEVLFNSYTQLHVSEAWKEVIPEEVYQMHQPFYQSLFALAHTPRCLQHLCRCTLRKLF
GRKCLHLVPLLPLPKPLQNYLLLEPEGVLH
Download sequence
Identical sequences G5AY45
HGL_H00000386532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]