SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386609 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386609
Domain Number 1 Region: 341-589
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-73
Family BEACH domain 0.0000666
Further Details:      
 
Domain Number 2 Region: 1630-1934
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.96e-36
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 214-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000439
Family Protein kinases, catalytic subunit 0.041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386609
Domain Number - Region: 805-832,869-1016,1139-1169
Classification Level Classification E-value
Superfamily ARM repeat 0.00187
Family GUN4-associated domain 0.073
Further Details:      
 
Domain Number - Region: 869-971,1195-1252,1284-1436
Classification Level Classification E-value
Superfamily ARM repeat 0.0134
Family HEAT repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386609
Sequence length 1936
Comment WDR81 (Homo_sapiens) WD repeat domain 81
Sequence
MAQGSKGREVALTTRAVGWSPAPSPDMEELLKCVERDLNIDARQLAPAPEGTHVVALVPV
RWLASLRERRLGPCPRAEGLGEAEVRTLLQRSVQRLPSGWTRVEVHGLRKRRLTYPLSGG
LSFEEGSSSPETLTRFMQEVAGQNYRNLWRHAYRTYGRPYSHTRTPSAVPALDSVRQALQ
GVYGCSFLPVGETTQCPSYARDGPCPSPGSPACPSLLRAEALLESPEMLYVIHPYVQFSL
HDVVTFSPAKLTNSQAKVLFILFRVLRAMDACHRQGLACGALSLYHIAIDEKLCSELRLD
LSSYEMSMKDENKETPVVRDGTGIKSEKEEAGSPGCPICREELKGLVLDWVHGRISNFHY
LMQLNRLAGRRQGDPNYHPVLPWVVDFTTPHGRFRDLRKSKFRLNKGDKQLDFTYEMTRQ
AFVAGGAGSGEPPHVPHHISDVLSDITYYVYKARRTPRSVLCGHVRAQWEPHEYPASMER
MQAWTPDECIPEFYTDPSIFCSIHPDMPDLDVPAWCSSSQEFVAAHQALLESREVSQDLH
HWIDLTFGYKLQGKEAVKEKNVCLHLVDAHTHLTSYGVVQLFDQPHPQRLAGVPALGPEP
PVISRLLVQAIQEATGREDFPRPLTNGVGRLVLEATPCEAGWTRDRPVAGEDDLEQATEA
LDSISLPGKASDQLGTSSSQAPSGLLSFSAASGPRPGRRNKATGADLGEGEEGKILLPEG
FSPLQALEELEKMGNFLARGLGGQLEVPEQPQVQPPVQLQDLFQRDMQALGVLLAEMVFA
TRVRTLQSDAPLWVRFTAVRGLCVCHPKEVPVSLQPVLDTLLQLSGSEGSVVAKRGKLNP
LFEYKPISQGLPPPSPAQLLSPFSSVVPFPPYFPALHRFILLYQARHVEDEAQGRELVFT
LWQQLGSVLSDITPEGLEILLPFVLSLMSEEHTAVYTAWYLFEPVAKALGPKNANKYLLK
PLIGAYESPCQLHGRFYLYTDCFVAQLMVRLGLQAFLVHLLPHVLQVLAGMEASQEESKG
FGGATEDEESELPGAGSTSCAFGEEMQMDEEAAGSSGLGLPDYTSGVSFHDQADLPETED
FQAGLYVAESPKPQEVEAVSLGRLSDKSSTSEASLGEERTADDGGVPVDKNSLRSGDSSQ
DLKQSEGSEEEEEEEEGCVVEEEEGEQEEVTGASELTLSDTVLSMETVVASGTRGDREEE
EEPLTEESEGKEQKILLDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGPTRQQF
TVSSGESPPLGASNIYQKRPVVGDVVSGPVLSCLLHIAHLYGEPVLTYQYLPYISYLVAP
GSNSSPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEVLLPVLSFLTSLVT
GFPSGAQARTVLCMKTISLIALICLRIGQEMVQQHLSEPVAIFFQVFSQLHELRQQDLQL
DPEGCDEGQLPETAFSDGQWRPVDLGLLDELQKVFTLEMAYMIYVSFSCLLGDIIRKIVP
NHELVGELAELYLESINTSSHNPASVEPTMANTDPEWDPQSGGSSQDDGHSGTFGSVLIG
NRIQIPNDSQPENLGPLDPISGMGGGGLGCGSEDNALKRELPRSAHGLSGNWLAYWQYEI
GVSQQDAHFHFHQIRLQSFPGHSGAVKCVAPLSSEDFFLSGSKDRTVRLWPLYNYGDGTS
DTAPRLIYAQHRKSVFYVGQLEAPQYVVSCDGAVHVWDPFTGKTLRTVESSDSRGPLTAV
AVVPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRSLAVSPSGRSVVAGF
SSGFMVLLDTRTGLVLRGWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQKPMHHY
KSASDPIHTFDVYGSEVVTGTVANKIGVCSLLEPPSQATTKLSSENFRGTLTSLALLPTK
RHLLLGSDNGIIRLLA
Download sequence
Identical sequences G5BCV2
HGL_H00000386609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]