SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386741 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386741
Domain Number 1 Region: 265-466
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000483
Further Details:      
 
Domain Number 2 Region: 18-151
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-26
Family SH2 domain 0.000000579
Further Details:      
 
Domain Number 3 Region: 198-259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386741
Sequence length 466
Comment CHN1 (Homo_sapiens) chimerin (chimaerin) 1
Sequence
MCLMSSERLENERLEKSRGEVYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAA
DQLLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTD
GLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMGVLKETHDEKDAAGQDGV
SEKRLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADC
GLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNS
EGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDA
YPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRQVTGLEVTLHEKENLM
NAENLGIVFGPTLMRSPEQDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences G5C943
HGL_H00000386741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]