SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386796 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386796
Domain Number 1 Region: 914-1110,1138-1160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-23
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 2 Region: 274-496
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-19
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number 3 Region: 697-845,883-900
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-18
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386796
Domain Number - Region: 1168-1213
Classification Level Classification E-value
Superfamily EF-hand 0.000379
Family Penta-EF-hand proteins 0.061
Further Details:      
 
Domain Number - Region: 1173-1305
Classification Level Classification E-value
Superfamily EF-hand 0.0218
Family Polcalcin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386796
Sequence length 1345
Comment SCN7A (Homo_sapiens) sodium channel, voltage-gated, type VII, alpha
Sequence
MASPELKGLVPFSKKSLELIKQHIAKKHDEENEDDDLKPNPDLEVGKKLPLIYGSLSGGM
VSEPLEDVDPYYYRNKKLFFWLLDQCPEGYVCVKAGKNPDHGSSNFDNLGWAFLALFRLM
TQDYPEALYHQILYSSGKIYMIFFVVVTVWFAFYMASLFLGILSMAYEKEKQTASEKTEI
EPKLQQTIKALQEGNEAAETKTTQIEMKKRLPTCLSTSVEMLEESTFRHKEEFNKSRKKC
PLCWYRIAKAFLIWDCSLCWLKLKDFVHRIIMNPFTDLFIFICIILNTHILALEHYPMSE
DTSYFLSIGNIACIGIFTAEMILKIIAMHPYQYFQVGWNIFDSIIVFLGLTELFLASIER
LSILQIFKLGKYWPTFRRLILTLGNSLMALKDLILLLFTFVFFSAVFGMKLFGQSYKDCV
CRIDKDCHLPRWHMHDFFHSYLLVFRILCGEWIETLWDCMEVGGQSSCICFYMMVILIGN
LLILYLFLGCVSSFLSYKDATTEENNEAKNIQLAIASIKKGINYVLVKILCKKQNIQEKT
TDHVNDTYVKENISDHTLSELSNTQDLPQDKEKISDTEKNTMTENESQSLMPSPSVSETV
PIASGESDIENLDNKEIQSKSESGESKGKIKQSSSSECSTVDIAISEEEMVNEHEKSKHL
INDRRRSSLGQISKEYKKGKIWQNIRKTCCKIVENSWFKCFIGLVTLLSTGALAFEDIYI
DQRKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNAWYRLDFMVVIVFCLSLIGK
TQEDLKPLASIKFLRALRVLSQFERMKVVVRALIKTTLPTWNVFLVCFMIWLSFSIMGVE
LFAGKFYACLDQPNGERFSVSEVWNITQCERLMYNESLSWKNAKMNFDNVGNGFLSLLQV
NMFQGFIFDLVTNRVFNAIIMVLICLQAMIMMIESDDQSLQMDLALYWINATFVMLYTVE
CILKLISFHCYYFTIVWNILDFMVVIFSITGLFLPMTVGHYLVPPSLVQLILLSRIIHIL
RLGKGPKVFHDLMVPLMLSLPALLNISLLIFLVMFIYAIFGMYNFAYVKKEAGINDVSNF
ETFGSSMICLFQVTIFAGWDGMLNAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFV
SYIFIIWLIIVNMYIVMVKEVLNIVSKKKTRTLSEDDFRKFFQVWKRFDPDRTQYIDSSQ
LSDFAAALDPPLFLAKPNKGQLVAMDLPMAVGDRIHCLDILLAFTKRVVGKDAGMEKILS
EIESAFALANPFKITYEPITTTLKRKQEAISATIIQRAYKNYRSRQNDKNTSDISTLDGD
QDAQGTKEGVCLDKTKEKSSIQNQI
Download sequence
Identical sequences HGL_H00000386796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]