SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386862 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386862
Domain Number 1 Region: 56-113
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.00079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386862
Domain Number - Region: 673-728
Classification Level Classification E-value
Superfamily SH3-domain 0.0441
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386862
Sequence length 971
Comment SH3BP4 (Homo_sapiens) SH3-domain binding protein 4
Sequence
MAAQRIRAANSSGLPRCKSEGTLIDLSEGFSETSFSDVKVPSPSALLVDNPTPFGNAKEV
IAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLSYRNSTLS
DSGMIDNLPDSPDEVAKELGLLGGWTDDQKESGKAYSNNPFWNGVQTNPFLNENVPVVAS
LDELKPKSTVDLLLFDTGTFTESSSATTNSTGNIFDELPATNGLHAEQPVKRDNPFFRSK
RSYSLSELSVLQAKSDDPAASSFFTGLKSPAPEQFQSREDFRTAWLNHRKLARSCHDLDL
LGQSPGWGQTQAVEMNIVCKLDSSGGAVQLPDTNISIHVPEGHVAPGEMQQISMKALLDP
PLELNSDKCSSVSPVLEVKLSNLEVNTFLILEMKVSAGVKSDVFSKSTVALQCLRSDSKE
GPYVAIPLTYSYGDTVQVQLDNLEPCMYLAIVAHGPSILYPSTVWDFIDKKVTVGLYGPK
HIHPSFKTVVTIFGHDCAPKTLLVSEVTRQGPSPAPVALQLWGKHQFVLAQPQDLQVGMF
SNMSNYKVKASEQARLVRGFQLKLGKVSRLIFPITSHSPGELSDFTLRVQVKDDRDAILT
QFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIILSPFAATTKYPTFQDRPVSSLKLGRLL
KTVVRQNKNQYLLEYKKGDVVALLSEERIRLRGQLWTKEWYIGYCQGKVGLVHAKNVLVV
GKARPSLCSGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENVSSWRAFADALGYGGQR
KRKPERVAPLTFFCRAELDSEPERVASVLEKLKEDCNNPDNKDRKSFQKELVMALLKMDC
QGLVVRLVQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWK
PAYDFLLTWSHQIGDSYRDVIQELHTGLDRMKSPITKRWKHLTGTLILVNSLDILRAAAF
SPVDHDDDFVI
Download sequence
Identical sequences G5AY42
HGL_H00000386862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]