SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386881 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386881
Domain Number 1 Region: 1170-1295
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.76e-27
Family Synaptotagmin-like (S variant) 0.0099
Further Details:      
 
Domain Number 2 Region: 2-134
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.05e-24
Family Synaptotagmin-like (S variant) 0.059
Further Details:      
 
Domain Number 3 Region: 1614-1717
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.56e-23
Family Synaptotagmin-like (S variant) 0.0095
Further Details:      
 
Domain Number 4 Region: 249-382
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.96e-20
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 5 Region: 1821-1978
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-18
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 6 Region: 392-521
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-17
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 7 Region: 1334-1452
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000109
Family PLC-like (P variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386881
Sequence length 2121
Comment DYSF (Homo_sapiens) dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)
Sequence
MLCCLLVRASNLPSVKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPL
DQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATSSLSASFNAPLLDTKQQPTGGSLVL
QVSYTPLPGAAPMFPSPASLEPSPTLPELDVVAGGGQSQAETWSLLSDSTVDTRYSGKKW
LAPTDTGGEEDTEDQGLTGDEAEPFLDPSGVPGPGAPTTPRKPPSRPPPYHPGSKRKRST
PPPRKLLSDKPQDFQIRVQVIKGHQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETL
FFNLFDSPEELFDEPIFITVVDSRSLRTDALIGEFRMDVGTIYREPRHAYLRKWLLLSDP
DDFSAGARGYLKASLCVLGPGDEAPLERKDPSEDREDIEGNLLRPTGVALRGAHFCLKIF
RAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQRV
TLPAMFPSMCEKMRIRVIDWDRLTHNDIVSTTYLSMSKISAPGGEIEADDNLGFLPTFGP
CYVNLYGSPREFTGFPDPYTELNMGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADDI
LRVEKYLRRRKYSLFAAFYSASMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRA
VFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNHLLRIADQLEAGLEQVHLALKAKC
STEDMDLLVAQLMDELIADCSQPLSNVLETPSATHLDQYLFRLRTRHLSQITEAALALKL
GHSELPAALEQAEDWLLRLQFLTPQPQNSLPDIVIWMLQGDKRVAYQRVPAHEVLFSRRG
TNYCGKNCGKLQTIFLKYPMEEVPGARMPVQIRVKLWFGLSVDEKEFNQFAEGKLSVFAE
TYENQTKLALVGNWGTTGLTYPKFSDITGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLH
DADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWS
TDLNRAVDEQGWEYSITIPPDRKPRHWVPAEKMYYTHRRRRWVRLRRRDLSQMDVLKRHR
QAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVV
DDRSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLPSMDKDSFSDPYAIVS
FLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPASIAEQPPSIVVELYDHDTYGADEFM
GRCICQPSLERMPRLAWFPLTKGSQPTGELLASFELIQREKPAIHHIPGFEVQDTSRILE
ESEDTDLPYPPPQKEANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLASISSPSLIVE
CGGQMVQSCVIRNLRKNPNFDVCTLFMEVMLPREELYCPPIVVKVIDNRQFGRRPVVGQC
TIRSLESFFCDPYTLESPSPQGGPDDMSLLSPGEDVLIDIDDKEPLIPVQLADGLSSLGP
TNMASSPSSPHEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTLLENVEDFEGLS
DFSNTFKLYRGKTQAESEDPSVIGEFKGLFKIYPLPEDPAIPIPPRQFHQLAAQGPQDCL
VRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPL
EKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPS
QLLHLFCQQHRIKAPLYRTDHVMFQDKEYKIEEIEAGRIPNPHLGPVEERLALHVLQQQG
LVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKALGRPGPPFNITPRKARRFFLRCIIWN
TRDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLP
AEQVCSVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGFLQLDLNRMPKPAKTA
EKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVAEEGEKRILAGKLEMTLEIVDESEHEE
RPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLF
LGIFVYAFPNYAAMKLVKPFS
Download sequence
Identical sequences G5AW46
HGL_H00000386881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]