SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386897 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386897
Domain Number 1 Region: 505-617
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.32e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.0005
Further Details:      
 
Domain Number 2 Region: 14-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-34
Family G proteins 0.00000189
Further Details:      
 
Domain Number 3 Region: 290-355,445-490
Classification Level Classification E-value
Superfamily PH domain-like 2.86e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 629-720
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-16
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386897
Sequence length 750
Comment AGAP1 (Homo_sapiens) ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
Sequence
DAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD
GQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLV
LVGTQDAISSTNPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRK
KQQLSIGPCKSLPNSPSHSSVCSAQVSAVHMSQTSNGGGSLSDYSSSVPSTPSTSQKELR
IDVPATANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLL
KRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRAT
SACAPISSPKTNGLSKDVSSLHISPNSDTGLGDSVCSSPSISSSTSPKLDPPPSPHANRK
KHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQI
LASLQSCESSKNKSRLTSQSEAMALQSIRNIRGNSHCVDCDTQNPNWASLNLGALMCIEC
SGIHRNLGTHLSRVRSLDLDDWPIELIQVMSSIGNELANSVWEESSRGRSKPSLDSPREE
KERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTVILLLAHGSRDEVNETCGES
DGRTALHLACRKGNVVLAQLLIWYGVDVMTRDAQGNTALAYARQASSQECIDVLLQYGCP
DERFVLMATPNLSRKNNNRNNSSGRVPSII
Download sequence
Identical sequences G5AY43
HGL_H00000386897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]