SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386911 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386911
Domain Number 1 Region: 105-305
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 2-101
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-27
Family Pleckstrin-homology domain (PH domain) 0.0000128
Further Details:      
 
Weak hits

Sequence:  HGL_H00000386911
Domain Number - Region: 497-591
Classification Level Classification E-value
Superfamily Tropomyosin 0.0017
Family Tropomyosin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386911
Sequence length 597
Comment ARHGAP25 (Homo_sapiens) Rho GTPase activating protein 25
Sequence
MGWLKKQRSIVKNWQQRYFVLKAQQLYYYKDEEDSKPQGCMYLPGSTIKEIATNPEEAGK
FVFEVTPALWDLNRTAQDSYILMASSQAEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYE
QKFGSHLVPILVEKCVEFILEHGMNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDV
HTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLMNADEAKAQQELTKQLSILPRDNYSLL
SYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRD
HEVLFPKSKDTPLSPPAQKNDPKKPPVPRSSVGWDATEEPSMSRTDSFSNVTSDSDATSP
IASQPNDRHQDDSSKVPGEKPGDWKVQSRKRTQTLPNRKCFLTSAFPSTNSNKVEIFKNE
FWSPSSKAKVGEGHRRTMSQDLRHLSDSQRTSTYDNVPTLPGSHGDGVGTLSSPTSDFKR
DALASTNSETGPEGKNSAEEELDSLQKMVQDLRKQIETQKKTYEEQIKNLEKENYDVWAK
VVRLNEELEKEKKKFGALEISLRNVERSREDVERRNKVLEDEVKEFVKSMKEPKTDP
Download sequence
Identical sequences G5BNY5
HGL_H00000386911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]