SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387123 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387123
Domain Number 1 Region: 50-527
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-134
Family ALDH-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387123
Sequence length 539
Comment ALDH7A1 (Homo_sapiens) aldehyde dehydrogenase 7 family, member A1
Sequence
MWRLARALRVEATKFSKFSGPCNRPTSFMSTLLINEPQYAWLKELGLLEENEGVYNGSWG
GQGEVITTYCPVNNEPIARVRQASVADYEETVKKAREAWQVWADIPAPKRGEIVRQIGDA
LREKIGVLGNLVSLEMGKILVESMGEIQEYVDICDYAVGLSRMIGGPVLPSERPGHVLIE
QWNPVGLVGIITAFNFPVAVYGWNNAIALISGNVCLWKGAPTTSLISVAVTKIVAKVLED
NKLPGAICSLTCGGADIGTTMARDEQVNLLSFTGSTQVGKQVALMVQERFGKCLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQVRVG
NPLEPNVLYGPLHTKQSVSKFLGAVEEAKKGGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
APIVHTETFAPILYIIKFKNEEEAFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGV
VNVNIPTNGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFE
Download sequence
Identical sequences G5BHU2
HGL_H00000387123 XP_004854515.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]