SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387531 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387531
Domain Number 1 Region: 530-608
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000326
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 881-951
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000299
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  HGL_H00000387531
Domain Number - Region: 290-316
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000105
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 9-76
Classification Level Classification E-value
Superfamily PWI domain 0.00222
Family PWI domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387531
Sequence length 1000
Comment RBM26 (Homo_sapiens) RNA binding motif protein 26
Sequence
MVSKMIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVF
LQKETQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFQHQEKDIKKEEITKEEEREKKF
SRRLNHSPPQSSSRYRENRSRDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYS
RSRSRSWSKERLRDRDRDRSRTRSRSRTRSRERDLVKPKYDLDRADPLENNYTPVSSVPN
ISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEK
GFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNL
RPPVPPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPP
SLFTTDAYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSS
MRIVVDSESRKRTIGSGEPGGPAKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVP
PELNNISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIK
VYWHREGSAQQLQTTSPKVMQPLVQQTILPVVKQSVKERLGPVPSSTVEPAEAQSASSDL
PQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDN
NEAQKKKQEQGKRKQEILEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEILTKNITKL
KDEVKATSPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAK
RGILSSGRGRGIHSRGRGAAHGRGRARGRGRSVPGHVVVDHRPRALEISAFTESDREDLL
PHFAQYGEIEDYQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPITNISAV
ETEEIEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences G5B9T0
HGL_H00000387531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]