SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387907 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387907
Domain Number 1 Region: 158-302
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000233
Family Ankyrin repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000921
Family Ubiquitin-related 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387907
Sequence length 544
Comment C3orf16 (Homo_sapiens) Uncharacterized protein C3orf16
Sequence
MRIFIAFEGSFEPFDVSTDETVEAVKLMIKDYFHIPLSEDKQARRYLELVYAGAALRNSW
CLADIGISFCSTLKCFVKEEDKPTLYVFNAVTQETMPIIESISLLGKKVSDLRTLVTLRC
GFPMGVYCLRTPKGQEMYDCNALRDYHTDMGTTLRLDVWDGWKEFLMGCLLGQKLKVQRY
LSKEGPVLKYQKRVALYIAAFYGYIELTEWALQQGVRPHEAVGVHPYRAWCYEALHADVS
KCPIHAAAEAGQLLILKAFVNCSVLCLECKTAAGQTPLTIAFKHKHKDCALYLLSKMWSM
VSFLKISVPMRIYIKIKQWILRAQSHSLHKKQLCKSRVFGAKVGDTVMVDGFTTPKMTSK
SWHKTGNKDSQSNLSKLPPLKKHTANKKPVYALTISQKDTREQIPTFPPLGDTNKFSDLQ
RYQQQYKKKITATAKKKEGHVKNTYLPQVPLPPISRVGYSHPSFYYATPSADSLLRSSFE
SFSKHSGRTPRENAIYCLAVASAFKEKRWLQQLEIARALAKKSISNLTTQGGLTAGENLP
EVVL
Download sequence
Identical sequences G5BH53
HGL_H00000387907 XP_004834495.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]