SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387911 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387911
Domain Number 1 Region: 3-130,262-399
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.93e-60
Family CAF1-like ribonuclease 0.041
Further Details:      
 
Domain Number 2 Region: 166-251
Classification Level Classification E-value
Superfamily R3H domain 1.11e-32
Family R3H domain 0.0000178
Further Details:      
 
Domain Number 3 Region: 427-514
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000527
Family Canonical RBD 0.00000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387911
Sequence length 617
Comment PARN (Homo_sapiens) poly(A)-specific ribonuclease (deadenylation nuclease)
Sequence
ADFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERCFISLFQHSMDF
LLFQFGLCTFKYDYTDSKYIMKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFN
KVFCKGIPYLNQEEERQLREQYDEKRSQANGAGALAYVSPNTSKCPVTIPEDQKKFIDQV
VEKIEDLLQSEENKTLDLEPCTGFQRKLIYQTLSWKYPRGVHIETLETEKKERYVVISKV
NEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVVGHNMLLDVMHTIHQFYCPL
PADLKEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAE
GFPSYDTASEQLHEAGYDAYITGLCFISMANHLGSFLSPPKLHVSSRSKLIEPFFNKLFL
MRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKSSDLYQLFSAFGNIQISWIDDTSAFVS
LSQPEQVPIAVNTSRYAESYRIQTYADYVGKKQGDKQIKRKWTDDSWKEVDRKRLNTQSL
SHSLQSHYYPPDSFTATSTVKKRNLSPSPEAGSEDRVLGKSSDSDLEQADSCAEALSEGR
KKSKKLKRMKKELTPAG
Download sequence
Identical sequences G5B4F1
HGL_H00000387911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]