SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387965 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000387965
Domain Number - Region: 304-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00316
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387965
Sequence length 1144
Comment TRPM5 (Homo_sapiens) transient receptor potential cation channel, subfamily M, member 5
Sequence
MQPAQGSCPGSPPDASPRRVPGLCQGEVDFGGSGKNRGKFVKVPSSVAPSALFNLLLTEW
HLPAPNLVVSLVGEERPFPMKAWLRDVLRKGLVKAAQSTGAWILTSGLRVGLARHLGQAV
RDHSLASTSTKIRMVAIGIASLGHVLHRRLLDDAQEDTPIHYPEDDGGSQGPLAPLDSNL
SHFILVEPGTPGKRDELAELRLRLEEHISQQRTGYGGTGSIEIPVLCLLVNGDPGTLERM
SKAVEQAAPWLILAGSGGIADVLAALVNQPHLLVPQVAEKQLREKFPGEHFSWEAILHWT
KLLQHITSHPHLLTVYDFKQEASEDLDTVILKALVKACKSHSQEAQDYLDELKLAVAWDR
VDIAKSEIFSGDVEWKSCDLEEVMMDALVSNKPEFVRLFVDNGANVADFLTYGRLQQLYR
TVAPKSLLFRLLQHKHEEGRLALAGLSAQQSRELSTGSPAFSLHEVSRVLKDFLQDACRG
LYQDGWAASRRTVERGPAKRPMGQKWLLDLSQKSKDPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSRLETEAEVARTMREAKYEQLALDLFSECYSNSADRAFALLV
RRNRSWSRTTCLHLATEADTKAFFAHDGVQAFLTKIWWGEMATGTPILRLLGAFTCPALI
YTNLIIFSEDTPLRTGLEDLQELDSLDMEQSLLCSPGHGVEEPVKMSGAHGSRGPPAAFL
LTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFKPPPQGPSGPEVTLYFWVFTLVL
EEIRQGFFTAEDTHLVKKFSLYVEDNWNKCDMVAIFLFLVGVVCRMLPSVFEAGRTVLAM
DFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVATQALLHPHDG
RLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSVHPLLLEDSPSCPNLYANWLVILLLV
TFLLVTNVLLMNLLIAMFSYTFQVVQGNADTFWKFQRYHLIVEYHGRPALAPPLILLSHL
SLVLKRVFWKAVQHKREHLERDLPDPLDQKIITWETVQKENFLSNVEKRRRDSEGEVLRK
TAHRVDLVAKYLGGLREQEKQIKCLESQVNYCTLLLSSMADTLAPGGAYWSPGKDPALEM
DAQS
Download sequence
Identical sequences G5C2E6
HGL_H00000387965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]