SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000387996 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000387996
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-31
Family Canonical RBD 0.00000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000387996
Sequence length 597
Comment CSTF2 (Homo_sapiens) cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa
Sequence
MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS
PEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQTNIPTLITGNPQPVHGAGPGSGANVSVNQQNPQAPQAQSLGGMHIN
GAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQPQLGMPGSGPVSIERGQGTLQ
HSPVGPAGPASIERVQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGE
VEPRGYLGPPHQGPPMHHVPGHEGRGPPPHEMRGGPLAEPRPLMAEPRGPMLDQRGPPLD
GRGGRDPRGIDARGMEARAMEARGLDARGMDARAMEARAMEARAMEARAMEARAMEVRGM
EARGMDTRGPVPGPRGPIPSGIQGPSPINIGAVGPQGARQVPVMQGTGMQGASMQGGSQP
GGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
Download sequence
Identical sequences G5BT18
XP_004872636.1.39548 HGL_H00000387996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]