SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388311 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388311
Domain Number 1 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-27
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 114-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 199-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 655-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 707-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 480-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 1-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 12 Region: 59-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000847
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 13 Region: 753-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000475
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 14 Region: 161-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000306
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 15 Region: 329-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000314
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 16 Region: 245-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000218
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388311
Sequence length 792
Comment ZNF845 (Homo_sapiens) zinc finger protein 845
Sequence
DVAIEFSQEEWKGLDPAQRTLYRDVMLENYRNLVSLVSSNQRNPSSIKNNISHEYENDFL
QSPFFTQEQVMHISTKLYKRNECDKSFNQCSQFTVHQIVHAGEKQFLCDICGKVFNQKSN
LRSHQRMHTGEKPFKCNECGNFFRYRSSLSKHQKIHTGEKPYKCNECGKVFGCNAYLAVH
LIIHTGEKPFKCNECGKLFSRNSDLAYHCKIHSGEKPYKCTECEKVFRHKSYLACHQRIH
TGEKPYKCNECGQVFSLNSSLTHHRRIHIRERSYKCKECGKVFSHKSYLANHQRIHTGEK
PYKCNECGNVFCRKSSLAKHQRIHTGEKPYKCNECGKVFICNSYLAEHLIIHAREKPFKC
SECDKVFSRNSRLVCHLRIHTGEKPYKCSECGKVFREKSYLECHRRSHTGEKPYKCNDCG
KMFSLNSSLAHHRRIHTGEGPYKCNECGKVFSRKSYIAKHQRVHTGEKPYKCSHCGNVFC
RSQFTMHQIVHAGEEHFICDICSKVFNQKSNLISHRRMHTGEKPYKCNECGKVFNKKSYL
AEHQRIHTGEKPYKCNECGKAFRQKSDLASHRRIHTGEKPYKCNECGKAFRQKSDLASHR
RIHTGEKPYKCNECGKAFRQKSDLASHRRIHTGEKPYKCNECGKAFRQKSDLASHRSLAK
HRRIHTGEKPYKCNDCGKVFSVHSSLAKHRRIHTGEKPYKCNECGNVFCYKSSLTMHQNI
HSREKPYKCNECGNVFCYKSSLTMHQNIHSREKPFKCNECGKVFRRKSHLSSHHRIHTRE
KPYKCNQFGKIF
Download sequence
Identical sequences G5B3C4
HGL_H00000388311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]