SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388373 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388373
Domain Number 1 Region: 871-940
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000464
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 755-831
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000006
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 3 Region: 951-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000829
Family SAM (sterile alpha motif) domain 0.051
Further Details:      
 
Weak hits

Sequence:  HGL_H00000388373
Domain Number - Region: 141-355
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388373
Sequence length 1021
Comment PPFIA2 (Homo_sapiens) protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2
Sequence
MVPEKLLPLVQEQWDGSSEAPTSGLGAVGGMVAWKPIPLDQKQGDRGSEAPTSGLGAAGL
STVVWWSGVLCIFVVRNQIIALREQNVHIQRKMVSSEGSTESEHLEGMEPGQKVHEKRLS
NGSIDSTDDTSQIVELQELLEKQNYEMVQMKERLAALSSRVGEVEQEAETARKDLIKTEE
MNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQ
MEEKNRQLQERLELAEQKLQQTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHL
EGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVL
IQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTISRTHLDTSAELRY
SVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHHFESD
TEMSDIDDDDRETIFSSMDLLSPSGHSDAQTLAMMLQEQLDAINKEIRLIQEEKESTELR
AEEIENRVASVSLEGLNLARVHPGTSITASVTASSLASSSPPSGHSTPKLTPRSPAREMD
RMGVMTLPSDLRKHRRKIAVVEEDGREDKATIKCETSPPPTPRAIRMTHTLPSSYHNEAR
SSLSASLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGKKEKARLGQLRGFMETEA
AAQESLGLGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDGPTVVAWLELWLGMPAWY
VAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPS
GNVWVTHEEMENLAAPAKTCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVD
ARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRREASQHEIKDVLV
WSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQASPFV
L
Download sequence
Identical sequences G5ALZ1
HGL_H00000388373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]