SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388381 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388381
Domain Number 1 Region: 768-853
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-16
Family Tudor domain 0.0035
Further Details:      
 
Domain Number 2 Region: 633-720
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000388381
Domain Number - Region: 822-932
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00785
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388381
Sequence length 935
Comment AKAP1 (Homo_sapiens) A kinase (PRKA) anchor protein 1
Sequence
MLALLGWWWFFLRKKQVSSSEEQAESGAVALRAGPATVELLPMEEACPTVVFMPPSVIQL
TGQDESTASEPSMEPPALLQTNLPHRRAESSGSLPDSTDSRSQANSPKVELAVMGDEARS
VPLACPLTFPHETVQVYKREPALGRVPATEKHGPGEKARDREMGGAEGTGDAVLGGEVLD
EGLLPQECVLELENNKALGPPLVVGAVGALSKGECAVWKSLSGVVEPAPAELAREEETPA
PQITGGKARDKDLVERGKEEALDDNKKIEQAASQIISQVILKATEEVLATTVGKTAELVD
QAAAVQPQGQQEEKNCAPVSQETVSGQDGVEPTPATAGEAASPLSAALPSPGPLAGDLPP
PKTYVSCLSSPLSSPTKDRKPKNSAHPISLAPCLPPDTPLREPLDEASTPVEDATCVTCM
SDSQNVPSVASSGQCSDSVSTSELEDCCTETNSSPRDKAIITPQLPDSTEAFSNGLLKGE
LSDVGTEDGWSVDAEADHSGDTPLREPLDEASTPVEDATCVTCMSDSQNVPSVASSGQCS
AVVSTSELEDCCTETNSSPRDKAIITPQLDSTTEAFSNGLLKGELSDVGTEDGWSVDAEA
DHSGGSDGNSMDSESCGGGGRKTDSLSTQAGSDPKKVDLIVWEIEVPKHLVGRLIGKQGR
YVSFLKQTSGAKIYISTLPYTQNIQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPL
PSLALPSLPMTSWLMLPDGITVEVIVVSQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYS
QPGIPTLPTPVEITVICAAPGLDGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLR
QIRSDFVTLPFQGAEVLLDSVMPLSDDDRFSPEADAAMSEMTGNTALLAQVTSYSPTGLP
LIQLWSVVGDEVVLINRSLVERGLAQWVDSYYSSL
Download sequence
Identical sequences G5C5I7
HGL_H00000388381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]