SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388550 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388550
Domain Number 1 Region: 71-119
Classification Level Classification E-value
Superfamily RING/U-box 2.5e-18
Family RING finger domain, C3HC4 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388550
Sequence length 142
Comment RNF24 (Homo_sapiens) ring finger protein 24
Sequence
MRGAAPAPPPPGPPLAGGQQSTVCRCHLSRAGRSLADAPRQQLSARSSLSAASRRELTVS
HLRRHRRRARLCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLA
QLHSKQNHGPPQGPLPGAENIV
Download sequence
Identical sequences G5B4V2
HGL_H00000388550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]