SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388723 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388723
Domain Number 1 Region: 168-425
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-44
Family Kelch motif 0.0021
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily POZ domain 0.00000000118
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388723
Sequence length 458
Comment KBTBD13 (Homo_sapiens) kelch repeat and BTB (POZ) domain containing 13
Sequence
MPRGPEVPVQVWVGGQLFQAEQGLLVEHCGFFRGLFRSGMREARAAEVRLGALSAEGFRT
ALQVLRGQRPALAAEEELLQAVECAAFLQAPALARFLEHSLTTDNCALLCDAAAAFGLRD
VFHSAALFIRDGARELAAGLALPEARAYVATLRPSYYVALSTHTPAPGFLEDRSRTMCYL
DEEEDAWRTLAALPLEASTMLAGVATLGNKLYVVGGVRGASKEVVELGFCYDPDGGTWRE
FPSPHQPRYDPALAGFEGCLYAIGGEFQRMPVSSVERYDPAAGCWSFVADLPQPAAGVPC
AQARGRLFVCLWHPADTTTIVEYVTQTDAWQPVAELRRPQSYGHCMVAHRDSLYVVRNGP
SDDFLHCAIDCLNLVTGQWTALPGQFVNSKGALFTAVVRGDIVYTVNRLSTMLYAIEGGT
WRLLREKIGFPRPGSLQTFLLRLPPGAPGPVALPLPEL
Download sequence
Identical sequences G5AN64
HGL_H00000388723 XP_004855689.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]