SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000388725-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000388725-1
Domain Number 1 Region: 17-239
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.65e-61
Family Ankyrin repeat 0.00014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000388725-1
Domain Number - Region: 348-380,428-471
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00199
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 
Domain Number - Region: 577-683
Classification Level Classification E-value
Superfamily t-snare proteins 0.00322
Family t-snare proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000388725-1
Sequence length 712
Comment RAI14 (Homo_sapiens) retinoic acid induced 14
Sequence
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDVEKVASLLGKKGASATKQNSEGKTAFHLA
AAKGYVEYLRVMFTHGVDVTVQDTTGHSALHLAAKNGHHECIRKLLQSKCPAEDIDSSGK
TALHYAMAGGCLQAVQVLYEHKSPVNFKDLDGNIPLLLAVQNGHTEVCCFLLDHGADVNS
RDKNGRTALMLACEIGNSNIVEALIKKGTDINLVDSLGHNALHYSKLSENAGIQSPLLSK
ISQDADLKTPTKPKQHEQVSKISSERSGTPKKNALEESERNKEKVRELEEKLVKREKGAV
IKPPVEEYEEMKSSYCSVIENMNKEKVFLFEKYQEAQEEIMKLKDTLKIQITQEASDEAG
DMKEAMNRMIDELNKQVSELLQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQVS
NVSRAKAEEALSEMKSQYSKVLNELTQLKQLVDTQKENFVSITEHLQVITTLRTTGKEME
ETIGRLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSSYEKLQSSLESEVSVLTLKLK
ESVKEKEKVHSEVSQVQSEVSQVKREKENIQTLLKSKEEEINELLQKFQQAQEEIAEMKR
YSESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSSSKRQNQQLEVLQQQVKQL
QNQLAECKKHHQEVISVYRMHLLYAVQGQMDEDVQKVLTQILTMCKNQSQKK
Download sequence
Identical sequences G5B6Z0
HGL_H00000388725-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]