SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389039 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389039
Domain Number 1 Region: 396-550
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.13e-24
Family Synaptotagmin-like (S variant) 0.0012
Further Details:      
 
Domain Number 2 Region: 230-366
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.29e-20
Family Synaptotagmin-like (S variant) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389039
Sequence length 553
Comment SYT14 (Homo_sapiens) synaptotagmin XIV
Sequence
VSPEAVGFLSAVGVFIILMLLLFLYINKKFCFENVGGFPDLGSGYDTRKNSQDKMYNYVA
GGGPGSSSESEDEALGKYHEALSRRRNSGLAPGGSRPQSYAWETRQKYSPLCAEQDGYSS
EASVDGGNCIQRMRRTPPLDELQPPPYQDDSGSPHLSCTPSEVGDSKCEFPHCSNSPRCS
YNKCPSEGSTGREVESFHNKGFEEDVPSDSTAVLSPEDMSAQGSSSQLPKPFDPEPEAKY
GTLDVTFDYDSQEQKLLVTVTAVTDIPAYNRAGGNSWQVHLVLLPIKKQRAKTSIQRGPC
PVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVTL
EPSYNHSGCDSQASASEVSCSESVTSCQSLERGSVPEILIGLLYNATTGRLSAEVIKGSH
FKNLAANRPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSIRRGQPNPV
YKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELSHWTEMKESK
GQQVCRWHALLES
Download sequence
Identical sequences G5BAM7
HGL_H00000389039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]