SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389168 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389168
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-64
Family Ankyrin repeat 0.000000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389168
Sequence length 1027
Comment PPP1R12A (Homo_sapiens) protein phosphatase 1, regulatory (inhibitor) subunit 12A
Sequence
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPIASVTNANTSSTQAAPVAVTTPTLSSSQATPTSPIKKFPTSTTK
ISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVIRSASSPRLSSSL
DNKEKERDSKGTRLAYVTPTIPRRLASTSDIEEKENRDSLSLRTSSSYTRRKWEDDLKKN
SSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTAKITTGS
SSVGTQSSTSNRLWAEDGTEKEKDSVPTAVTIPVAPTVVNAAAPTTTLTTTTAGTVSSTS
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEEKEKQDKEKQEEKRESETSREDEYKQKYSRTYDETYPRYRPVSTSSSATSSS
HSTMSSSLYSSSQLNRPNSLVGITSAYSRGLTKENEREGEKKEDEKEGEDKSQPKSIRER
RRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSTSDRYDS
LLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQ
LEKATQRQERYTDRSLLEKEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIR
VISKLSK
Download sequence
Identical sequences G5C9J2
HGL_H00000389168 XP_004845048.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]