SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389667 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389667
Domain Number 1 Region: 322-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.63e-17
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 80-113
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000262
Family Intermediate filament protein, coiled coil region 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000389667
Domain Number - Region: 78-224
Classification Level Classification E-value
Superfamily Tropomyosin 0.0163
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389667
Sequence length 440
Comment KRT18P42 (Homo_sapiens) keratin 18 pseudogene 42
Sequence
MSVTTRSTTFSTNYRSLGSVRPPSHRVGRASSAASVYAGAGGSGSRVSVSRSTILRGDMA
SAGLASGMAGGLSGMGSIQTEKETMQDLNDRLASYLERVRSLETENRRLEGKIREHLEKK
GPQVRDWGHYFKTIEELKAQIFANSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVE
NDIHGLRKVIDDTSITRLQLETEIETLKEELMFMKKNHEEASKAAGQARDPGGQDKGLQA
QIASSGLTVEVDAPKSQDLSKIMGDIRAQYDALAQKNREELDKYWSQQIEETTTVITSQS
AEVGAAESTLMELKRTAQSLEIDLESMRNLKISLENSLRDLEARYAMQMEQLNGVLLHLE
SELAQTRTEGQRQAQEYEALVKLEAEIATYRRLLEDGEDFNLGDALDSSTSVQTIQRTTT
RKIVDGKLVSETNDTKVLRH
Download sequence
Identical sequences G5BJ40
HGL_H00000389667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]