SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389951 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389951
Domain Number 1 Region: 113-204,408-492
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.57e-45
Family Canonical RBD 0.00000797
Further Details:      
 
Domain Number 2 Region: 13-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.54e-20
Family Canonical RBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389951
Sequence length 496
Comment CELF2 (Homo_sapiens) CUGBP, Elav-like family member 2
Sequence
NGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQN
PPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGM
VSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTM
EGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQAT
SSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSP
VAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAVAQMLSGMAALNGGLGATGL
TNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQ
EFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMK
RLKVQLKRSKNDSKPY
Download sequence
Identical sequences A0A2I2YIK8 A0A2K5IX91 G5BBE6
HGL_H00000389951 ENSGGOP00000019913 ENSGGOP00000019913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]