SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000390625 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000390625
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-19
Family Canonical RBD 0.00000367
Further Details:      
 
Domain Number 2 Region: 261-351
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.43e-16
Family Canonical RBD 0.0039
Further Details:      
 
Domain Number 3 Region: 101-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000494
Family Canonical RBD 0.00025
Further Details:      
 
Weak hits

Sequence:  HGL_H00000390625
Domain Number - Region: 387-462
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000284
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000390625
Sequence length 479
Comment HNRPLL (Homo_sapiens) heterogeneous nuclear ribonucleoprotein L-like
Sequence
EAGGSHHKVSVSPVVHVRGLCESVVEADLVDALEKFGTICYVMMMPFKRQALVEFENIDS
AKECVTFAADEPVYIAGQQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVD
VLYTVCNPVGKVQRIVIFKRNGIQAMFMFESVLCAQKAKAALNGADIYAGCCTLKIEYAR
PTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSR
YRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIE
KVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFELEDG
TSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFI
KYKVFDAKPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHL
Download sequence
Identical sequences G5CA72
HGL_H00000390625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]